Recombinant Full Length Brucella Melitensis Biotype 1 Putative Peptide Transport System Permease Protein Bmeii0209(Bmeii0209) Protein, His-Tagged
Cat.No. : | RFL21059BF |
Product Overview : | Recombinant Full Length Brucella melitensis biotype 1 Putative peptide transport system permease protein BMEII0209(BMEII0209) Protein (Q8YDG7) (1-315aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Brucella melitensis biotype 1 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-315) |
Form : | Lyophilized powder |
AA Sequence : | MMTALILKRVAQAIPVMLIVAILTFLLMKLLPGDPAILIAGDGASPETVERIRVELGLDQ PTVVQLGQWLWNLFHFDLGRSFLLSQPVSQAIAERLPVTISLALLAFAITIPVGIIMGVV AAYLRDSWFDTGVMSLALLGVSVPSFWLAILAVILFSVTLGWFPSAGYVPFLDSPLGWLR SLILPASILALFQIGYLARMTRSEMLEVMDQDYIRTARSKGVSEYSVLSTHAFRNALVSV LTVSGYIFSLLIGGSVVIEQIFALPGLGRLLVQAILARDLPVVQGTMLFLGFLFVAINVL VDILYTIADPRVRYD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BMEII0209 |
Synonyms | BMEII0209; Putative peptide transport system permease protein BMEII0209 |
UniProt ID | Q8YDG7 |
◆ Recombinant Proteins | ||
SAP085B-002-1611S | Recombinant Staphylococcus aureus (strain: SK1396, other: AsaCdHg) SAP085B_002 protein, His-tagged | +Inquiry |
SNX2-8549M | Recombinant Mouse SNX2 Protein, His (Fc)-Avi-tagged | +Inquiry |
TMEM39A-3289H | Recombinant Human TMEM39A Protein, His-tagged | +Inquiry |
SLIT3-754H | Recombinant Human SLIT3 protein, His-tagged | +Inquiry |
RFL3111HF | Recombinant Full Length Human Bcl-2-Like Protein 13(Bcl2L13) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Vtn-694M | Native Mouse Vitronectin | +Inquiry |
DDIM-6H | Native Human D-dimer protein | +Inquiry |
CRP-159M | Native Rhesus Monkey C-Reactive Protein | +Inquiry |
COL3A1-001H | Native Human COL3A1 Protein | +Inquiry |
FSHB-672H | Native Human Follicle Stimulating Hormone, Beta Polypeptide | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTPN9-518HCL | Recombinant Human PTPN9 lysate | +Inquiry |
Brain-42C | Cynomolgus monkey Brain Lysate | +Inquiry |
UBR7-203HCL | Recombinant Human UBR7 cell lysate | +Inquiry |
MRPL42-4167HCL | Recombinant Human MRPL42 293 Cell Lysate | +Inquiry |
Peripheral Blood Leukocyte (PBL)-44H | Human Peripheral Blood Leukocyte (PBL) Tissue Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BMEII0209 Products
Required fields are marked with *
My Review for All BMEII0209 Products
Required fields are marked with *
0
Inquiry Basket