Recombinant Full Length Human Bcl-2-Like Protein 13(Bcl2L13) Protein, His-Tagged
Cat.No. : | RFL3111HF |
Product Overview : | Recombinant Full Length Human Bcl-2-like protein 13(BCL2L13) Protein (Q9BXK5) (1-485aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-485) |
Form : | Lyophilized powder |
AA Sequence : | MASSSTVPLGFHYETKYVVLSYLGLLSQEKLQEQHLSSPQGVQLDIASQSLDQEILLKVK TEIEEELKSLDKEISEAFTSTGFDRHTSPVFSPANPESSMEDCLAHLGEKVSQELKEPLH KALQMLLSQPVTYQAFRECTLETTVHASGWNKILVPLVLLRQMLLELTRRGQEPLSALLQ FGVTYLEDYSAEYIIQQGGWGTVFSLESEEEEYPGITAEDSNDIYILPSDNSGQVSPPES PTVTTSWQSESLPVSLSASQSWHTESLPVSLGPESWQQIAMDPEEVKSLDSNGAGEKSEN NSSNSDIVHVEKEEVPEGMEEAAVASVVLPARELQEALPEAPAPLLPHITATSLLGTREP DTEVITVEKSSPATSLFVELDEEEVKAATTEPTEVEEVVPALEPTETLLSEKEINAREES LVEELSPASEKKPVPPSEGKSRLSPAGEMKPMPLSEGKSILLFGGAAAVAILAVAIGVAL ALRKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BCL2L13 |
Synonyms | BCL2L13; MIL1; CD003; Bcl-2-like protein 13; Bcl2-L-13; Bcl-rambo; Protein Mil1 |
UniProt ID | Q9BXK5 |
◆ Recombinant Proteins | ||
RFL29571MF | Recombinant Full Length Mouse Bcl-2-Like Protein 13(Bcl2L13) Protein, His-Tagged | +Inquiry |
Bcl2l13-1848M | Recombinant Mouse Bcl2l13 Protein, Myc/DDK-tagged | +Inquiry |
BCL2L13-154H | Recombinant Human BCL2L13 Protein, GST-tagged | +Inquiry |
RFL3111HF | Recombinant Full Length Human Bcl-2-Like Protein 13(Bcl2L13) Protein, His-Tagged | +Inquiry |
BCL2L13-1600HF | Recombinant Full Length Human BCL2L13 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BCL2L13-61HCL | Recombinant Human BCL2L13 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BCL2L13 Products
Required fields are marked with *
My Review for All BCL2L13 Products
Required fields are marked with *
0
Inquiry Basket