Recombinant Human SLIT3 protein, His-tagged

• Cat.No.: SLIT3-754H
• Product Overview: Recombinant Human SLIT3 protein(O75094)(34-155aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 34-155aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 17.9 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: CPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRG

Gene Information

• Gene Name: SLIT3 slit homolog 3 (Drosophila) [ Homo sapiens ]
• Official Symbol: SLIT3
• Synonyms: SLIT3; slit homolog 3 (Drosophila); SLIL2, slit (Drosophila) homolog 3; slit homolog 3 protein; MEGF5; Slit 3; SLIT1; slit2; multiple EGF-like domains protein 5; multiple epidermal growth factor-like domains protein 5; SLIL2; Slit-3; FLJ10764
• Gene ID: 6586
• mRNA Refseq: NM_003062
• Protein Refseq: NP_003053
• MIM: 603745
• UniProt ID: O75094