Recombinant Human TMEM39A Protein, His-tagged

• Cat.No.: TMEM39A-3289H
• Product Overview: Recombinant Human TMEM39A(191-297aa) fused with His tag was produced in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 191-297aa
• Form: The purified protein was resolved in 1M PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.) added with 300mM Imidazole and 15% glycerol.
• AA sequence: YPFGVYVPLCCFHQDSRAHLLLTDYNYVVQHEAVEESASTVGGLAKSKDFLSLLLESLKEQFNNATPIPTHSCPLSPDLIRNEVECLKADFNHRIKEVLFNSLFSAY
• Storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles.
• Shipping: The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade.

Gene Information

• Gene Name: TMEM39A transmembrane protein 39A [ Homo sapiens ]
• Official Symbol: TMEM39A
• Synonyms: TMEM39A; transmembrane protein 39A; FLJ10902
• Gene ID: 55254
• mRNA Refseq: NM_018266
• Protein Refseq: NP_060736
• UniProt ID: Q9NV64