Recombinant Full Length Brucella Melitensis Biotype 1 Flagellar M-Ring Protein(Flif) Protein, His-Tagged
Cat.No. : | RFL11697BF |
Product Overview : | Recombinant Full Length Brucella melitensis biotype 1 Flagellar M-ring protein(fliF) Protein (Q8YDM4) (1-580aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Brucella melitensis biotype 1 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-580) |
Form : | Lyophilized powder |
AA Sequence : | MAVVWMQQNFQQLIEQLKGTLGKLGARKLIALGLVGAALMGAILYTSIYLGRPSYETLYV GLSRDDVNRMGLALGEAGIPFDVKSDGSSILVPIGKAENARMYLAEKGLPTSNNAGYELF DNMGSLGLTSFMQEITRVRALEGEIARTIQAIRGVKAARVHIVLAEKGSFRRGDQKPSAS VVIRAEGGFSAESAQSIRQLVAAAVPSLDASSVTVLDTNGHLLASAGEGANGAALMTASL EQQVASHVDDSIRKALAPYLGLGHFQTSVQAALDTDRRQTKETTYDPESRVERSVRVVRE SGDSRNNRNDNATGVEQNIPQEQIQNRNGESSTEKTDRREELTNYEVNSMTVSTVSDGYS IKRLSIAVVIDQARLLQTAGTTPPPANFVDQQITKIRDLVATAAGLNTNRGDVINVTAVN FLDSAGADMEPVSAPWTDTLLRQSGSYANALAILAAVGLLIWFGLRPLLRDQNVKPAGTE VAIREAGEVATPNFIGGAESVGEGVQAVIGGPAAYADQMKTSLSDLRQRMRMPAKLRLEQ MIEMDEERVAAVLKQWIHETASGREADPAKASAMPELKAA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | fliF |
Synonyms | fliF; BMEII0151/BMEII0152; Flagellar M-ring protein |
UniProt ID | Q8YDM4 |
◆ Recombinant Proteins | ||
RFL12083HF | Recombinant Full Length Haemophilus Influenzae Putative Uncharacterized Symporter Hi_1315 (Hi_1315) Protein, His-Tagged | +Inquiry |
SUK-0014P2-2393S | Recombinant Staphylococcus aureus (strain: 18811) SUK_0014P2 protein, His-tagged | +Inquiry |
MORC2-1193Z | Recombinant Zebrafish MORC2 | +Inquiry |
CYP7A1-6743H | Recombinant Human CYP7A1 protein, His-tagged | +Inquiry |
AXL-920H | Recombinant Human AXL Protein, DDK/His-tagged | +Inquiry |
◆ Native Proteins | ||
FBa-12H | Native Human Factor Ba protein | +Inquiry |
GC-524H | Native Human GC protein | +Inquiry |
C3-365H | Active Native Human C3 Protein | +Inquiry |
Fxa-282B | Active Native Bovine Factor Xa - EGR | +Inquiry |
SUOX-248G | Active Native Chicken Sulfite Oxidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
ENPEP-001HCL | Recombinant Human ENPEP cell lysate | +Inquiry |
RGP1-541HCL | Recombinant Human RGP1 lysate | +Inquiry |
MYC-4039HCL | Recombinant Human MYC 293 Cell Lysate | +Inquiry |
PPP2R2D-2922HCL | Recombinant Human PPP2R2D 293 Cell Lysate | +Inquiry |
MORF4L1-4252HCL | Recombinant Human MORF4L1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All fliF Products
Required fields are marked with *
My Review for All fliF Products
Required fields are marked with *
0
Inquiry Basket