Recombinant Full Length Bacillus Subtilis Flagellar M-Ring Protein(Flif) Protein, His-Tagged
Cat.No. : | RFL12426BF |
Product Overview : | Recombinant Full Length Bacillus subtilis Flagellar M-ring protein(fliF) Protein (P23447) (1-536aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus subtilis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-536) |
Form : | Lyophilized powder |
AA Sequence : | MNRTLMQMKNKTSEFWKNRSKLQKILMVSALAAIIIIGIIISVFASNSKMAPLYKDLSAE EAGQIKEELDAKKVPNELSNGGTVISVPEDQVDSLKVQMAAEGLPKTGSIDYSFFGQNAG FGLTDNEFDMVKVKATQTELSNLINEMDGIKNSKVMINLPKDAVFVGEEQSAASASIVLQ IQPGYTLDQSQINGLYHLVSKSVPNLKEDNIVIMDQNSTYYDKSDSDAGSYADSYSSQQG IKSQVEKDIQKHVQSLLGTMMGQDKVVVSVTADIDFTKENRTEDIVEPVDKENMEGIAVS AEKVSETYQGDGAANGGTAGTGEEDVTNYKADGENTESGNYEKNSNKINYEVNRIHKEIA ESPYKVRDLGIQVMVEPPDAKNTASLSTERQDDIQKILSTVVRTSLDKDETQNQNLSDAD INNKIVVSVQPFDGKVNLDTNTEESSGIPLWAYIVGGVLIAAIIVLIIMLIRKKRAQEDE FEEYEYEVPQEPINLPDINEEENETAESVRRKQLEKMAKDKPEDFAKLLRSWLAED |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | fliF |
Synonyms | fliF; BSU16210; Flagellar M-ring protein |
UniProt ID | P23447 |
◆ Recombinant Proteins | ||
REN-3665R | Recombinant Rhesus Macaque REN Protein, His (Fc)-Avi-tagged | +Inquiry |
CST9L-301566H | Recombinant Human CST9L protein, GST-tagged | +Inquiry |
DDX5-1046R | Recombinant Rhesus Macaque DDX5 Protein, His (Fc)-Avi-tagged | +Inquiry |
ERH-493H | Recombinant Human ERH protein(Met1-Lys104), His-tagged | +Inquiry |
MRAW-3336S | Recombinant Staphylococcus epidermidis ATCC 12228 MRAW protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
APOB-613H | Native Human Apolipoprotein B (including Ag(x) antigen) | +Inquiry |
IgG Fc-07H | Native Human Immunoglobulin G Fc (IgG Fc) | +Inquiry |
LDH-228H | Native Human Lactate Dehydrogenase Total | +Inquiry |
Lectin-1813P | Active Native Peanut Lectin Protein, Biotinylated | +Inquiry |
APOE-5283H | Native Human Apolipoprotein E | +Inquiry |
◆ Cell & Tissue Lysates | ||
FUK-676HCL | Recombinant Human FUK cell lysate | +Inquiry |
SURF2-1336HCL | Recombinant Human SURF2 293 Cell Lysate | +Inquiry |
IFNA13-847MCL | Recombinant Mouse IFNA13 cell lysate | +Inquiry |
KXD1-8203HCL | Recombinant Human C19orf50 293 Cell Lysate | +Inquiry |
CA10-2485HCL | Recombinant Human CA10 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All fliF Products
Required fields are marked with *
My Review for All fliF Products
Required fields are marked with *
0
Inquiry Basket