Recombinant Full Length Brucella Suis Biovar 1 Flagellar M-Ring Protein Flif(Flif) Protein, His-Tagged
Cat.No. : | RFL515BF |
Product Overview : | Recombinant Full Length Brucella suis biovar 1 Flagellar M-ring protein FliF(fliF) Protein (Q8FUS3) (1-580aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Brucella suis biovar 1 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-580) |
Form : | Lyophilized powder |
AA Sequence : | MAVVWMQQNFQQLIEQLKGTLGKLGARKLIALGLVGAALMGAILYTSIYLGRPSYETLYV GLSRDDVNRMGLALGEAGIPFDVKSDGSSILVPIGKAENARMYLAEKGLPTSNNAGYELF DNMGSLGLTSFMQEITRVRALEGEIARTIQAIRGVKAARVHIVLAEKGSFRRGDQKPSAS VVIRAEGGFSAESAQSIRQLVAAAVPSLDASSVTVLDTNGHLLASAGEGANGAALMTASL EQQVASHVDDSIRKALAPYLGLGHFQTSVQAALDTDRRQTKETTYDPESRVERSVRVVRE SGDSRNNRNDNATGVEQNIPQEQIQNRNGESSTEKTDRREELTNYEVNSKTVSTVSDGYS IKRLSIAVVIDQARLLQTAGTTPPPANFVDQQITKIRDLVATAAGLNTNRGDVINVTAVN FLDPAGADMEPVSAPWTDTLLRQSGSYANALAILAAVGLLIWFGLRPLLRDQNVKPAGTE VAIREAGEVATPNFIGGAESVGEGVQAVIGGPAAYADQMKTSLSDLRQRMRMPAKLRLEQ MIEMDEERVAAVLKQWIHETASGREADPAKASAMPELKAA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | fliF |
Synonyms | fliF; BRA1146; BS1330_II1137; Flagellar M-ring protein FliF |
UniProt ID | Q8FUS3 |
◆ Recombinant Proteins | ||
RFL5006DF | Recombinant Full Length Dictyostelium Discoideum Autophagy-Related Protein 9(Atg9) Protein, His-Tagged | +Inquiry |
SCO5085-557S | Recombinant Streptomyces coelicolor A3(2) SCO5085 protein, His-tagged | +Inquiry |
ERMP1-2142R | Recombinant Rat ERMP1 Protein | +Inquiry |
SEPT5-14895M | Recombinant Mouse SEPT5 Protein | +Inquiry |
B2M-0234H | Recombinant Human B2M Protein (Met1-Met119), C-His-tagged | +Inquiry |
◆ Native Proteins | ||
toxB-11C | Native C. difficile toxB | +Inquiry |
LDL-394H | Native Human Low Density Lipoprotein, Biotin labeled | +Inquiry |
Interferon alfa-P031H | Native Human interferon alpha therapeutic protein (Interferon alfa-n1) | +Inquiry |
DIP-25 | Active Native NADPH dehydrogenase | +Inquiry |
ELANE-8236H | Native Human Neutrophil Elastase (ELA-2) | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHST8-7505HCL | Recombinant Human CHST8 293 Cell Lysate | +Inquiry |
ALPP-8893HCL | Recombinant Human ALPP 293 Cell Lysate | +Inquiry |
NAT8L-3960HCL | Recombinant Human NAT8L 293 Cell Lysate | +Inquiry |
UGT3A1-1881HCL | Recombinant Human UGT3A1 cell lysate | +Inquiry |
SLC26A11-1755HCL | Recombinant Human SLC26A11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All fliF Products
Required fields are marked with *
My Review for All fliF Products
Required fields are marked with *
0
Inquiry Basket