Recombinant Full Length Rhizobium Meliloti Flagellar M-Ring Protein(Flif) Protein, His-Tagged
Cat.No. : | RFL9393RF |
Product Overview : | Recombinant Full Length Rhizobium meliloti Flagellar M-ring protein(fliF) Protein (O54239) (1-557aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhizobium Meliloti |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-557) |
Form : | Lyophilized powder |
AA Sequence : | MNLFDQFSTFTKNLSNLGQGKLIALAVAGVVAIGFVLGAGIYVNRPSFETLYVGLERSDV TQISIALAEANVDFEVGTDGGSIQVPVGMTGKARLLLAERGLPSSANAGYELFDNVGSLG LTSFMQEVTRVRALEGEIARTIQQISGIAAARVHIVMPERGSFRKAEQTPTASVMIRASA TVGRSAASSIRHLVASSVPGLDVDDVTVLDSTGQLLASGDDPSNSALNQSLGVVQNVQSD LEKKIDNALAPFLGMDNFRTSVTARLNTDAQQIQETVFDPESRVERSTRVIKEEQKSSQQ QPDNAATVQQNVPQAAPRGGAGQQSSDEAEKKEEQTNYEINSKTIATVKNSYSIERLSIA VVVNRGRLAAMAGEPADQAKIDAYLQEMQKIVSSAAGIDPGRGDVVTLNAMDFVETQLLD QAVPGPGIMEMLTRNLGGIINALAFVAVAFLVVWFGMRPLARQLGFGGQAGKLEGEAAGL ELPDFSPAGAGAGGALMEGFGSDFGFDGGDDLLNLGDEAGFNRRVKEGPERRLARMVEIS EERAAKILRKWAVDRAA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | fliF |
Synonyms | fliF; R00646; SMc03014; Flagellar M-ring protein |
UniProt ID | O54239 |
◆ Recombinant Proteins | ||
NUDT1-3775R | Recombinant Rat NUDT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Srr-6135M | Recombinant Mouse Srr Protein, Myc/DDK-tagged | +Inquiry |
ADAM17-501R | Recombinant Rat ADAM17 Protein | +Inquiry |
EIF4G2-3423C | Recombinant Chicken EIF4G2 | +Inquiry |
APRT-729H | Recombinant Human APRT protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
ALB-314H | Native Human Albumin Fluorescein | +Inquiry |
Chylomicrons-192H | Native Human Chylomicrons | +Inquiry |
CP-26450TH | Native Human CP | +Inquiry |
AZU1-26565TH | Native Human AZU1 | +Inquiry |
MUC16-1H | Native Human MUC16 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAU-6320HCL | Recombinant Human FAU 293 Cell Lysate | +Inquiry |
ERBB2-2658HCL | Recombinant Human ERBB2 cell lysate | +Inquiry |
Occipital Lobe-36H | Human Occipital Lobe Tissue Lysate | +Inquiry |
SUDS3-1363HCL | Recombinant Human SUDS3 293 Cell Lysate | +Inquiry |
APPL1-8772HCL | Recombinant Human APPL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All fliF Products
Required fields are marked with *
My Review for All fliF Products
Required fields are marked with *
0
Inquiry Basket