Recombinant Full Length Bovine Prostacyclin Receptor(Ptgir) Protein, His-Tagged
Cat.No. : | RFL26460BF |
Product Overview : | Recombinant Full Length Bovine Prostacyclin receptor(PTGIR) Protein (P79393) (1-382aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-382) |
Form : | Lyophilized powder |
AA Sequence : | MADSCRNLTYVRDSVGPATSTLMFVAGVVGNGLALGILGARRHSRPSAFAVLVTGLGVTD LLGTCFLSPAVFAAYARNSSLLGLARGRPALCDAFAFAMTFFGLASTLILFAMAVERCLA LSHPYLYAQLDGPRRARLALPAIYAFCTIFCSLPFLGLGQHQQYCPGSWCFIRMRSAEPG GCAFLLAYASLVALLVAAIVLCNGSVTLSLCRMYRQQRRHQARCPRPRAGEDEVDHLILL ALMTGIMAVCSLPLTPQIRGFTQAIAPDSSEMGDLLAFRFNAFNPILDPWVFILFRKSVF QRLKLWFCCLYSRPAQGDSRTSLSQSASGRKDSSAPPALEGKKGNWVPLSAWGEGQGGPL PAVQLPTSTVGTPSKAGSEAAC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PTGIR |
Synonyms | PTGIR; Prostacyclin receptor; Prostaglandin I2 receptor; PGI receptor; PGI2 receptor; Prostanoid IP receptor |
UniProt ID | P79393 |
◆ Recombinant Proteins | ||
STAP1-3786HF | Recombinant Full Length Human STAP1 Protein, GST-tagged | +Inquiry |
Clec4f-856M | Recombinant Mouse Clec4f Protein, Fc-tagged | +Inquiry |
TOR1B-5820H | Recombinant Human TOR1B Protein (Asn98-Thr328), N-His tagged | +Inquiry |
Cyp3a9-137R | Active Recombinant Rat Cyp3a9 Protein | +Inquiry |
UBE3A-13HFL | Recombinant Human UBE3A Peorein (Full length), N His-FLAG tagged | +Inquiry |
◆ Native Proteins | ||
F2-5287M | Native Mouse Coagulation Factor II | +Inquiry |
CKMM-382H | Native Human Creatine Kinase MM (CK-MM) | +Inquiry |
APOA2-5302H | Native Human Apolipoprotein A-II | +Inquiry |
APOA2-8036H | Native Human ApoLipoprotein APOA2 | +Inquiry |
Lectin-1787G | Active Native Griffonia Simplicifolia Lectin II Protein, Agarose bound | +Inquiry |
◆ Cell & Tissue Lysates | ||
GMFB-5883HCL | Recombinant Human GMFB 293 Cell Lysate | +Inquiry |
LARP1-969HCL | Recombinant Human LARP1 cell lysate | +Inquiry |
PCYT1A-3366HCL | Recombinant Human PCYT1A 293 Cell Lysate | +Inquiry |
LPL-4665HCL | Recombinant Human LPL 293 Cell Lysate | +Inquiry |
FOXJ1-663HCL | Recombinant Human FOXJ1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PTGIR Products
Required fields are marked with *
My Review for All PTGIR Products
Required fields are marked with *
0
Inquiry Basket