Recombinant Full Length Bovine Gap Junction Alpha-3 Protein(Gja3) Protein, His-Tagged
Cat.No. : | RFL22287BF |
Product Overview : | Recombinant Full Length Bovine Gap junction alpha-3 protein(GJA3) Protein (P41987) (2-407aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (2-407) |
Form : | Lyophilized powder |
AA Sequence : | GDWSFLGRLLENAQEHSTVIGKVWLTVLFIFRILVLGAAAEEVWGDEQSDFTCNTQQPGC ENVCYDRAFPISHVRFWVLQIIFVSTPTLIYLGHVLHLVRMEEKRKEREEEPPKAAGPEG HQDPAPVRDDRGKVRIAGALLRTYVFNIIFKTLFEVGFIAGQYFLYGFQLKPLYRCDRWP CPNTVDCFISRPTEKTIFILFMLAVACVSLLLNVLEIYHLGWKKLKQGMTSPFRPDTPGS RAGSVKPVGGSPLLLPPNSAPPAVTIGFPPYYAPSASSLGQASAPGYPEPPPPAALPGTP GTPGGGGNQGLRARAQNWANREAEPQTSSRKASPPAPTPPAAESPGGGPQQSLPEGAAGS SGDSDGEGAVTAVELHAPPEPPADPGRSSKASKSSGGRARAGDLAI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GJA3 |
Synonyms | GJA3; Gap junction alpha-3 protein; Connexin-44; Cx44 |
UniProt ID | P41987 |
◆ Recombinant Proteins | ||
SSRP1A-12068Z | Recombinant Zebrafish SSRP1A | +Inquiry |
GlpQ -12B | Recombinant Borrelia Miyamotoi GlpQ protein, His-tagged | +Inquiry |
ADAMTS18-1315M | Recombinant Mouse ADAMTS18 Protein | +Inquiry |
FABP5-4424HF | Recombinant Full Length Human FABP5 Protein, GST-tagged | +Inquiry |
FAIM3-2941M | Recombinant Mouse FAIM3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
LALBA-8173H | Native Human Lactalbumin | +Inquiry |
Lectin-1740A | Active Native Aleuria Aurantia Lectin Protein | +Inquiry |
Lectin-1792A | Active Native Artocarpus integrifolia Jacalin Protein, Agarose bound | +Inquiry |
Lectin-1787G | Active Native Griffonia Simplicifolia Lectin II Protein, Agarose bound | +Inquiry |
SNCA-27342TH | Native Human SNCA | +Inquiry |
◆ Cell & Tissue Lysates | ||
LY9-2112MCL | Recombinant Mouse LY9 cell lysate | +Inquiry |
Lung-314P | Porcine Lung Lysate | +Inquiry |
NPTX2-1213HCL | Recombinant Human NPTX2 cell lysate | +Inquiry |
ARL6IP4-123HCL | Recombinant Human ARL6IP4 cell lysate | +Inquiry |
RARB-2513HCL | Recombinant Human RARB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All GJA3 Products
Required fields are marked with *
My Review for All GJA3 Products
Required fields are marked with *
0
Inquiry Basket