Recombinant Full Length Sheep Gap Junction Alpha-3 Protein(Gja3) Protein, His-Tagged
Cat.No. : | RFL29042OF |
Product Overview : | Recombinant Full Length Sheep Gap junction alpha-3 protein(GJA3) Protein (Q9TU17) (2-413aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sheep |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (2-413) |
Form : | Lyophilized powder |
AA Sequence : | GDWSFLGRLLENAQEHSTVIGKVWLTVLFIFRILVLGAAAEEVWGDEQSDFTCNTQQPGC ENVCYDRAFPISHVRFWVLQIIFVSTPTLIYLGHVLHLVRMEEKRKEREEEPPKAAGPAE EHQDPAPVRDDRGKVRIAGALLRTYVFNIIFKTLFEVGFIAGQYFLYGFQLKPLYRCDRW PCPNTVDCFISRPTEKTIFILFMLAVACVSLLLNVLEIYHLGWKKLKQGMTSPFRPDTPG SRAGSAKPMGGSPLLLPPNSAPPAVTIGFPPYYAPSASSLGQASAPGYPEPPLPAALPGT PGTPGTPGTLGGGGGNQGLRAPAQNCANREAEPQTSARKASPPASTPPAAPAGGPQQFLP GGAAGSSGDSDGEGAVTAVELHAPPEPPADPGRSSKASKSSGGRARAADLAI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GJA3 |
Synonyms | GJA3; Gap junction alpha-3 protein; Connexin-44; Cx44 |
UniProt ID | Q9TU17 |
◆ Recombinant Proteins | ||
COX10-1732H | Recombinant Human COX10 Protein, GST-tagged | +Inquiry |
DPH3-4076HF | Recombinant Full Length Human DPH3 Protein, GST-tagged | +Inquiry |
BHLHA9-1026M | Recombinant Mouse BHLHA9 Protein, His (Fc)-Avi-tagged | +Inquiry |
CD63-2946H | Active Recombinant Human CD63 Full Length Transmembrane protein(Nanodisc) | +Inquiry |
EFCAB11-2543Z | Recombinant Zebrafish EFCAB11 | +Inquiry |
◆ Native Proteins | ||
HbA1c-199H | Native Human Hemoglobin A1C | +Inquiry |
alpha Thrombin native protein-3287H | Native Human alpha Thrombin | +Inquiry |
LALBA-8173H | Native Human Lactalbumin | +Inquiry |
Collagen type I-03H | Native Human Collagen type I Protein | +Inquiry |
CGA-1855H | Native Human, Glycoprotein Hormones, Alpha Polypeptide | +Inquiry |
◆ Cell & Tissue Lysates | ||
Amygdala-1H | Human Amygdala(Alzheimer's Disease) Membrane Lysate | +Inquiry |
PAIP2-3458HCL | Recombinant Human PAIP2 293 Cell Lysate | +Inquiry |
SYTL3-1298HCL | Recombinant Human SYTL3 293 Cell Lysate | +Inquiry |
LRRC71-100HCL | Recombinant Human LRRC71 lysate | +Inquiry |
TUBB4A-647HCL | Recombinant Human TUBB4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GJA3 Products
Required fields are marked with *
My Review for All GJA3 Products
Required fields are marked with *
0
Inquiry Basket