Recombinant Full Length Chicken Gap Junction Alpha-3 Protein(Gja3) Protein, His-Tagged
Cat.No. : | RFL21593GF |
Product Overview : | Recombinant Full Length Chicken Gap junction alpha-3 protein(GJA3) Protein (P29415) (2-511aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chicken |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (2-511) |
Form : | Lyophilized powder |
AA Sequence : | GDWSFLGRLLENAQEHSTVIGKVWLTVLFIFRILVLGAAAEEVWGDEQSDFTCNTQQPGCENVCYDKAFPISHIRFWVLQIIFVSTPTLIYLGHVLHIVRMEEKRKEKEEELKKRGSVKDNNYPGAATSGGGSGGGNNFKDPPIKMGKEKLPIRDERGRIRMGGALLRTYIFNIIFKTLFEVGFIVGQYFLYGFELKPVYQCSRPPCPHTVDCFISRPTEKTIFIIFMLVVASVSLLLNMLEIYHLGWKKLKQGMTSQYSLEMPVTTLTPVMVTGESKPVSLPPPAPPVVVTTTAPAPVLPDTRAVTPLLAPVTMAPYYAAAAPRTRPPSNTASMASYPVAPPVPENRHRAVTPTPVSTPVTIPTPIPTPTPAIINYFNSKSNALAAEQNWVNMAAEQQGKAPSSSAGSSTPSSVRHPLPEQEEPLEQLLPLPAGPPITTTNSGSSTSLSGASGSKWDVEGEEELAEERPISATCTTVEMHEPPLLVDTRRLSRASKSSSSRARSDDLAV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GJA3 |
Synonyms | GJA3; Gap junction alpha-3 protein; Connexin-56; Cx56 |
UniProt ID | P29415 |
◆ Recombinant Proteins | ||
RFL4305MF | Recombinant Full Length Mouse Gap Junction Alpha-3 Protein(Gja3) Protein, His-Tagged | +Inquiry |
GJA3-11837Z | Recombinant Zebrafish GJA3 | +Inquiry |
GJA3-2546R | Recombinant Rat GJA3 Protein | +Inquiry |
GJA3-3420C | Recombinant Chicken GJA3 | +Inquiry |
RFL22287BF | Recombinant Full Length Bovine Gap Junction Alpha-3 Protein(Gja3) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GJA3 Products
Required fields are marked with *
My Review for All GJA3 Products
Required fields are marked with *
0
Inquiry Basket