Recombinant Full Length Mouse Gap Junction Alpha-3 Protein(Gja3) Protein, His-Tagged
Cat.No. : | RFL4305MF |
Product Overview : | Recombinant Full Length Mouse Gap junction alpha-3 protein(Gja3) Protein (Q64448) (2-417aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (2-417) |
Form : | Lyophilized powder |
AA Sequence : | GDWSFLGRLLENAQEHSTVIGKVWLTVLFIFRILVLGAAAEEVWGDEQSDFTCNTQQPGC ENVCYDRAFPISHIRFWALQIIFVSTPTLIYLGHVLHIVRMEEKKKEREEELLRRDNPQH GRGREPMRTGSPRDPPLRDDRGKVRIAGALLRTYVFNIIFKTLFEVGFIAGQYFLYGFQL QPLYRCDRWPCPNTVDCFISRPTEKTIFVIFMLAVACASLVLNMLEIYHLGWKKLKQGVT NHFNPDASEARHKPLDPLPTATSSGPPSVSIGFPPYYTHPACPTVQAKAIGFPGAPLSPA DFTVVTLNDAQGRNHPVKHCNGHHLTTEQNWTRQVAEQQTPASKPSSAASSPDGRKGLID SSGSSLQESALVVTPEEGEQALATTVEMHSPPLVLLDPGRSSKSSNGRARPGDLAI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gja3 |
Synonyms | Gja3; Gap junction alpha-3 protein; Connexin-46; Cx46 |
UniProt ID | Q64448 |
◆ Recombinant Proteins | ||
CDKN2D-33H | Recombinant Human CDKN2D protein | +Inquiry |
ACVR2B-63C | Recombinant Cynomolgus ACVR2B, Fc tagged | +Inquiry |
TNFSF13B-319H | Recombinant Active Human TNFSF13B Protein, His-tagged(C-ter) | +Inquiry |
CLDN15A-10715Z | Recombinant Zebrafish CLDN15A | +Inquiry |
DCUN1D1-11871H | Recombinant Human DCUN1D1, GST-tagged | +Inquiry |
◆ Native Proteins | ||
GC-524H | Native Human GC protein | +Inquiry |
Lectin-1752A | Active Native Aleuria Aurantia Lectin Protein, Biotinylated | +Inquiry |
KS-01G | Active Native Goat KS Protein | +Inquiry |
IgA-241F | Native Ferret Immunoglobulin A | +Inquiry |
HBA2-27787TH | Native Human HBA2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
C6orf136-7995HCL | Recombinant Human C6orf136 293 Cell Lysate | +Inquiry |
Aorta-484C | Chicken Aorta Lysate, Total Protein | +Inquiry |
KPNA3-4890HCL | Recombinant Human KPNA3 293 Cell Lysate | +Inquiry |
ARHGEF6-119HCL | Recombinant Human ARHGEF6 cell lysate | +Inquiry |
NOSTRIN-3757HCL | Recombinant Human NOSTRIN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Gja3 Products
Required fields are marked with *
My Review for All Gja3 Products
Required fields are marked with *
0
Inquiry Basket