Recombinant Full Length Bovine Coronavirus Hemagglutinin-Esterase(He) Protein, His-Tagged
Cat.No. : | RFL6284BF |
Product Overview : | Recombinant Full Length Bovine coronavirus Hemagglutinin-esterase(HE) Protein (P15776) (19-424aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | BtCoV |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (19-424) |
Form : | Lyophilized powder |
AA Sequence : | FDNPPTNVVSHLNGDWFLFGDSRSDCNHVVNTNPRNYSYMDLNPALCDSGKISSKAGNSI FRSFHFTDFYNYTGEGQQIIFYEGVNFTPYHAFKCTTSGSNDIWMQNKGLFYTQVYKNMA VYRSLTFVNVPYVYNGSAQSTALCKSGSLVLNNPAYIAREANFGDYYYKVEADFYLSGCD EYIVPLCIFNGKFLSNTKYYDDSQYYFNKDTGVIYGLNSTETITTGFDFNCHYLVLPSGN YLAISNELLLTVPTKAICLNKRKDFTPVQVVDSRWNNARQSDNMTAVACQPPYCYFRNST TNYVGVYDINHGDAGFTSILSGLLYDSPCFSQQGVFRYDNVSSVWPLYSYGRCPTAADIN TPDVPICVYDPLPLILLGILLGVAVIIIVVLLLYFMVDNGTRLHDA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HE |
Synonyms | HE; 2b; Hemagglutinin-esterase; HE protein; EC 3.1.1.53; E3 glycoprotein |
UniProt ID | P15776 |
◆ Recombinant Proteins | ||
PILRB-1720H | Recombinant Human PILRB, GST-tagged | +Inquiry |
CD300LF-903R | Recombinant Rat CD300LF Protein, His (Fc)-Avi-tagged | +Inquiry |
WFIKKN1-18540M | Recombinant Mouse WFIKKN1 Protein | +Inquiry |
VLP-351S | Recombinant SARS-CoV-2 (B1.1.529, Omicron) Virus-Like Particles | +Inquiry |
RBM45-6786Z | Recombinant Zebrafish RBM45 | +Inquiry |
◆ Native Proteins | ||
EDN2-8310H | Native Human EDN2 | +Inquiry |
IgA-252H | Native Human Immunoglobulin A | +Inquiry |
PIP-20H | Native Human PIP Protein (118 aa) | +Inquiry |
TF-172S | Native Sheep transferrin | +Inquiry |
Collagen Type I-01B | Native Bovine Collagen Type I (Atelocollagen) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAK16-4531HCL | Recombinant Human MAK16 293 Cell Lysate | +Inquiry |
Pituitary-649B | Bovine Pituitary Lysate, Total Protein | +Inquiry |
RPAP2-2238HCL | Recombinant Human RPAP2 293 Cell Lysate | +Inquiry |
DTYMK-6791HCL | Recombinant Human DTYMK 293 Cell Lysate | +Inquiry |
IFT88-5271HCL | Recombinant Human IFT88 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HE Products
Required fields are marked with *
My Review for All HE Products
Required fields are marked with *
0
Inquiry Basket