Recombinant Full Length Murine Coronavirus Hemagglutinin-Esterase(He) Protein, His-Tagged
Cat.No. : | RFL20177MF |
Product Overview : | Recombinant Full Length Murine coronavirus Hemagglutinin-esterase(HE) Protein (Q83356) (23-439aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Murine coronavirus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (23-439) |
Form : | Lyophilized powder |
AA Sequence : | FGFNEPLNIVSHLNDDWFLFGDSRSDCTYVENNGHPKLDWLDLDPKLCNSGKISAKSGNS LFRSFHFTDFYNYTGEGDQIVFYEGVNFSPNHGFKCLAYGDNKRWMGNKARFYARVYEKM AQYRSLSFVNVPYAYGGKAKPTSICKHKTLTLNNPTFISKESNYVDYYYESEANFTLAGC DEFIVPLCVFNGHSKGSSSDPANKYYMDSQSYYNMDTGVLYGFNSTLDVGNTAKDPGLDL TCRYLALTPGNYKAVSLEYLLSLPSKAICLRKPKRFMPVQVVDSRWNSTRQSDNMTAVAC QLPYCFFRNTSADYSGGTHDVHHGDFHFRQLLSGLLLNVSCIAQQGAFLYNNVSSSWPAY GYGQCPTAANIGYMAPVCIYDPLPVVLLGVLLGIAVLIIVFLILYFMTDSGVRLHEA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HE |
Synonyms | HE; 2b; Hemagglutinin-esterase; HE protein; E3 glycoprotein |
UniProt ID | Q83356 |
◆ Recombinant Proteins | ||
PGF-30907TH | Recombinant Human PGF | +Inquiry |
E-04D | Recombinant DENV2 E Protein, His-tagged | +Inquiry |
Ncr3-1816R | Recombinant Rat Ncr3 protein, His & T7-tagged | +Inquiry |
BDNF-04H | Active Recombinant Human BDNF Protein | +Inquiry |
CTAG1A-677H | Recombinant Human CTAG1A Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Factor B-60H | Native Human Factor B | +Inquiry |
PLD-19S | Active Native Streptomyces sp. Phospholipase D, Type VII | +Inquiry |
HPX-206H | Native Human Native Human HPX | +Inquiry |
GLDH-213B | Active Native Bovine Glutamate Dehydrogenase | +Inquiry |
Factor 4-88H | Native Human Platelet Factor 4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAP2K5-4509HCL | Recombinant Human MAP2K5 293 Cell Lysate | +Inquiry |
F7-1973HCL | Recombinant Human F7 cell lysate | +Inquiry |
CRABP2-7295HCL | Recombinant Human CRABP2 293 Cell Lysate | +Inquiry |
KCNG4-5061HCL | Recombinant Human KCNG4 293 Cell Lysate | +Inquiry |
SLC6A3-1637HCL | Recombinant Human SLC6A3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HE Products
Required fields are marked with *
My Review for All HE Products
Required fields are marked with *
0
Inquiry Basket