Recombinant Full Length Human Coronavirus Oc43 Hemagglutinin-Esterase(He) Protein, His-Tagged
Cat.No. : | RFL29214HF |
Product Overview : | Recombinant Full Length Human coronavirus OC43 Hemagglutinin-esterase(HE) Protein (P30215) (17-424aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human coronavirus OC43 (HCoV-OC43) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (17-424) |
Form : | Lyophilized powder |
AA Sequence : | FYNPPTNVVSHVNGDWFLFGDSRSDCNHIVNINPHNYSYMDLNPVLCDSGKISSKAGNSI FRSFHFTDFYNYTGEGQQIIFYEGVNFTPYHAFKCNRSGSNDIWMQNKGLFYTQVYKNMA VYRSLTFVNVPYVYNGSAQSTALCKSGSLVLNNPAYIAPQANSGDYYYKVEADFYLSGCD EYIVPLCIFNGKFLSNTKYYDDSQYYFNKDTGVIYGLNSTETITTGFDLNCYYLVLPSGN YLAISNELLLTVPTKAICLNKRKDFTPVQVVDSRWNNARQSDNMTAVACQPPYCYFRNST TNYVGVYDINHGDAGFTSILSGLLYNSPCFSQQGVFRYDNVSSVWPLYPYGRCPTAADIN NPDLPICVYDPLPVILLGILLGVAVIIIVVLLLYFMVDNGTRLHDA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HE |
Synonyms | HE; 2b; Hemagglutinin-esterase; HE protein; E3 glycoprotein |
UniProt ID | P30215 |
◆ Recombinant Proteins | ||
CD81-151H | Recombinant Human CD81 Protein, His-tagged | +Inquiry |
KLK10-171H | Recombinant Human KLK10, His-tagged | +Inquiry |
ZNF451-5145R | Recombinant Rhesus Macaque ZNF451 Protein, His (Fc)-Avi-tagged | +Inquiry |
ALDH1L1-302R | Recombinant Rhesus monkey ALDH1L1 Protein, His-tagged | +Inquiry |
Inhbb-221M | Recombinant Active Mouse INHBB Protein, His-tagged(C-ter) | +Inquiry |
◆ Native Proteins | ||
CDA007 | Native Human Cancer Antigen 72-4 | +Inquiry |
Lectin-1733L | Active Native Lens Culinaris Agglutinin Protein, Rhodamine labeled | +Inquiry |
ALB-8301S | Native Sheep ALB | +Inquiry |
FSH-1566P | Active Native Porcine Stimulating Hormone | +Inquiry |
CA2-33R | Native Rat Carbonic Anhydrase II (CA2) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CER1-338HCL | Recombinant Human CER1 cell lysate | +Inquiry |
NFIA-3853HCL | Recombinant Human NFIA 293 Cell Lysate | +Inquiry |
ZNF821-4HCL | Recombinant Human ZNF821 293 Cell Lysate | +Inquiry |
TXN2-714HCL | Recombinant Human TXN2 lysate | +Inquiry |
PRR15-2814HCL | Recombinant Human PRR15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HE Products
Required fields are marked with *
My Review for All HE Products
Required fields are marked with *
0
Inquiry Basket