Recombinant Full Length Putative Apolipoprotein N-Acyltransferase(Lnt) Protein, His-Tagged
Cat.No. : | RFL22628BF |
Product Overview : | Recombinant Full Length Putative apolipoprotein N-acyltransferase(lnt) Protein (P61033) (1-541aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bordetella parapertussis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-541) |
Form : | Lyophilized powder |
AA Sequence : | MSPAGKGPAWRQPAILAAAGAAHALSFAPDPLPAWSLAPVQVIALAVAAHASLQAPSARR ALARGWLFAMFSFSLGLYWLYVSMHDYGGLAAPLAAAGVLALSAFLALFPGLACAAARWL CPPHWDASPPARARRTLYTAATWAACWAALEWLRAVVLTGFPWLNIGYAHVDSPLAGWAP LLGVHGMALLAAFAAAALAGLWQSASGRIDSRQALAAGVALLLAGAGWLLGQFSWSRPEG KPLHLRLVQGNVEQSQKFDPALLETGLRRHLELASLPPRPGEPKPDLIILPETVLPVFQD QLPASVWDAWIEVARRADTRIAMGVPLHTQPDGATGHRYTNSVIGFDASTPVEQLRTGTT AMRYDKQHLVPWGEYVPPGFRWFVDMLDIPLGDFDRGAARQPSFDIAGQRIAFNICYEDL FGPGLLPALQDGPDGRPGATIMANVSNLGWFGNTWALRQHLQIGRLRTMETARPMVAATN TGITAAIDARGRVAAALPAGRAGVLPVAVQGMTGLTPYARFGDKPALALIGLLLIAAPAL G |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lnt |
Synonyms | lnt; BPP1137; Putative apolipoprotein N-acyltransferase; ALP N-acyltransferase |
UniProt ID | P61033 |
◆ Recombinant Proteins | ||
SCARB2-1959H | Recombinant Human SCARB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
VIPR2-6525R | Recombinant Rat VIPR2 Protein | +Inquiry |
TAF1L-219H | Recombinant Human TAF1L Protein, GST-tagged | +Inquiry |
MATN3-622H | Recombinant Human MATN3 Protein, MYC/DDK-tagged | +Inquiry |
PLSCR3-4195R | Recombinant Rat PLSCR3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
CFH-115H | Active Native Human Factor H | +Inquiry |
NPPB-8052R | Native Rat Brain Natriuretic Peptide-32 | +Inquiry |
Deoxycholate-03T | Native Toxoplasma Gondii Deoxycholate Lysate, RH strain | +Inquiry |
IgA-240B | Native Bovine Immunoglobulin A | +Inquiry |
FGA-39B | Native Bovine Fibrinogen, FITC Labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CNKSR3-001HCL | Recombinant Human CNKSR3 cell lysate | +Inquiry |
ISOC1-5144HCL | Recombinant Human ISOC1 293 Cell Lysate | +Inquiry |
CCM2-7719HCL | Recombinant Human CCM2 293 Cell Lysate | +Inquiry |
Tongue-532C | Cynomolgus monkey Tongue Lysate | +Inquiry |
PYDC1-2645HCL | Recombinant Human PYDC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All lnt Products
Required fields are marked with *
My Review for All lnt Products
Required fields are marked with *
0
Inquiry Basket