Recombinant Full Length Ralstonia Solanacearum Apolipoprotein N-Acyltransferase(Lnt) Protein, His-Tagged
Cat.No. : | RFL22832RF |
Product Overview : | Recombinant Full Length Ralstonia solanacearum Apolipoprotein N-acyltransferase(lnt) Protein (Q8Y210) (1-523aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Ralstonia solanacearum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-523) |
Form : | Lyophilized powder |
AA Sequence : | MRALFSSPAADTAGQQEALAVPLARLRFAAPLAALLGVMHTLAFAPNRWWWLQILSLAGL AALVRQAPRLRDVAWVGYAFGLGWFLSGIWWLYISMHVYGDMPAWMAAAAVLLFSAYLAL HPALAAWLWQRLARGRQLSGAASALVFGAAWLVSEWLRGTEWTGFPWLNGGYAHTDGPLA GYAPLVGVYGVVAIAATLAGLLCAAAERRLHWLAGLAGVAVLAAGWPLHTIAWTQPVGKP ITVRLLQGNVPQDVKFQQTGIDHSLALYTKMVTEQPAQLVVTPETAFPILLQDMPQEIAL AIRTYVDTTGSSVLFGAANADSAVDYTNSAFGVGPWFKGVYRYDKHHLVPFGEFIPFGFH WFVHMMNMPLGDFRRGLPVQPPMPVAGQRVAPNICYEDLFGEEIAASLRQAERPATMLAN VTNLAWFGDTIALDQHLQISRMRALESGRPMLRATNTGATAVVRPDGSVQARLPVFTLGT LQADVQGMQGLTPFVRTGNAPALGAGVLVLLAALARRRRAGAA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lnt |
Synonyms | lnt; RSc0527; RS04941; Apolipoprotein N-acyltransferase; ALP N-acyltransferase |
UniProt ID | Q8Y210 |
◆ Recombinant Proteins | ||
RFL7631SF | Recombinant Full Length Shigella Sonnei Protein Aaex(Aaex) Protein, His-Tagged | +Inquiry |
Ptprh-5699R | Recombinant Rat Ptprh protein, His & T7-tagged | +Inquiry |
DDX28-4411M | Recombinant Mouse DDX28 Protein | +Inquiry |
ADAM7-319M | Recombinant Mouse ADAM7 Protein, His (Fc)-Avi-tagged | +Inquiry |
IFNA-389C | Active Recombinant Cotton Rat IFNA | +Inquiry |
◆ Native Proteins | ||
HPX-84R | Native Rat Hemopexin | +Inquiry |
FGA-79H | Active Native Human Fibrinogen | +Inquiry |
Fetuin-5263B | Native Bovine Fetuin Protein | +Inquiry |
IgG-253R | Native Rabbit IgG Protein, Tag Free, Agarose Conjugated | +Inquiry |
IgG-148H | Native Human IgG Fab fragment | +Inquiry |
◆ Cell & Tissue Lysates | ||
SALL1-2075HCL | Recombinant Human SALL1 293 Cell Lysate | +Inquiry |
CR2-2201HCL | Recombinant Human CR2 cell lysate | +Inquiry |
XPA-262HCL | Recombinant Human XPA 293 Cell Lysate | +Inquiry |
GYPA-749HCL | Recombinant Human GYPA cell lysate | +Inquiry |
CERS4-4818HCL | Recombinant Human LASS4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All lnt Products
Required fields are marked with *
My Review for All lnt Products
Required fields are marked with *
0
Inquiry Basket