Recombinant Full Length Bordetella Bronchiseptica Apolipoprotein N-Acyltransferase(Lnt) Protein, His-Tagged
Cat.No. : | RFL4324BF |
Product Overview : | Recombinant Full Length Bordetella bronchiseptica Apolipoprotein N-acyltransferase(lnt) Protein (Q7WMN7) (1-547aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bordetella Bronchiseptica |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-547) |
Form : | Lyophilized powder |
AA Sequence : | MSPAGKGPAWRQPAILAAAGAAHALSFAPDPLPAWSLAPVQVIALAVAAHASLQAPSARR ALARGWLFAMFSFSLGLYWLYVSMHDYGGLAAPLAAAGVLALSAFLALFPGLACAAARWL CPPHWDASPPARARRTLYTAATWAACWAALEWLRAVVLTGFPWLNIGYAHVDSPLAGWAP LLGVHGMALLAAFAAAALAGLWQSASGRIDSRQALAAGVALLLAGAGWLLGQFSWSRPEG KPLHLRLVQGNVEQSQKFDPALLETGLRRHLELASLPPRPGEPKPDLIILPETVLPVFQD QLPASVWDAWIEVARRADTRIAMGVPLHTQPDGATGHRYTNSVIGFDASTPVEQLRTGTT AMRYDKQHLVPWGEYVPPGFRWFVDMLDIPLGDFDRGAARQPSFDIAGQRIAFNICYEDL FGPELLPALQDGPDGRPGATIMANVSNLGWFGNTWALRQHLQIGRLRTMETARPMVAATN TGITAAIDARGRVAAALPAGRAGVLPVAVQGMTGLTPYARFGDKPALALIGLLLIAAAAR GRRPRQP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lnt |
Synonyms | lnt; BB1353; Apolipoprotein N-acyltransferase; ALP N-acyltransferase |
UniProt ID | Q7WMN7 |
◆ Recombinant Proteins | ||
RFL321RF | Recombinant Full Length Rhizobium Meliloti Probable K(+)/H(+) Antiporter Subunit F(Phaf) Protein, His-Tagged | +Inquiry |
GSTM1-3360HF | Recombinant Full Length Human GSTM1 Protein, GST-tagged | +Inquiry |
FRRS1-3366M | Recombinant Mouse FRRS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
EGFR-9938H | Active Recombinant Human EGFR protein, GST-tagged | +Inquiry |
OSBPL8-3251R | Recombinant Rhesus monkey OSBPL8 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
IAP-8323C | Active Native Bovine IAP | +Inquiry |
Thrombin-12S | Native Atlantic salmon Thrombin | +Inquiry |
RBP-246H | Native Human Retinol Binding Protein | +Inquiry |
IgA-251G | Native Goat Immunoglobulin A | +Inquiry |
HbA1c-19M | Native Mouse Glycated Hemoglobin A1c (HbA1c) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
VTN-2062MCL | Recombinant Mouse VTN cell lysate | +Inquiry |
MKX-4298HCL | Recombinant Human MKX 293 Cell Lysate | +Inquiry |
PF4-3283HCL | Recombinant Human PF4 293 Cell Lysate | +Inquiry |
KCTD10-5011HCL | Recombinant Human KCTD10 293 Cell Lysate | +Inquiry |
MXD3-4047HCL | Recombinant Human MXD3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All lnt Products
Required fields are marked with *
My Review for All lnt Products
Required fields are marked with *
0
Inquiry Basket