Recombinant Full Length Bacillus Pseudofirmus Upf0754 Protein Bpof4_11355 (Bpof4_11355) Protein, His-Tagged
Cat.No. : | RFL12907BF |
Product Overview : | Recombinant Full Length Bacillus pseudofirmus UPF0754 protein BpOF4_11355 (BpOF4_11355) Protein (O87557) (1-379aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus pseudofirmus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-379) |
Form : | Lyophilized powder |
AA Sequence : | MDTAWFIGFMVVIGAVIGGATNSLAIKMLFRPYTEKRIGKWRVPFTPGLIPKRHQELAIQ LGHMVVHYLLTAEGLGKKLKSAVFMKAMNDWLSTELLKLLRSELTIGELLEDKLGVKEPK QTLLQKTEGLIEKSYDRFFQENRYKQIGEVLPRGVNEKIDHSVPVIAAFLLERGQALFSS EEGKERLSKMIDRFLLNKGTLGNMISMFLGNERLVDKLQPELMKFMRDDGTKRMVEEILE KEWAKLKQKDVALIEDQLNKEDIVEYMTTALEKNVTFYQWVDQPLCDWSEPFEDMLVINW VPKLVDAVSDLLALHLEGLLEKLNLEDIVREQVEAFSVERLEELVLTISKREFKMITYLG ALLGGMIGFIQGLLVLFIG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BpOF4_11355 |
Synonyms | BpOF4_11355; UPF0754 protein BpOF4_11355 |
UniProt ID | O87557 |
◆ Recombinant Proteins | ||
NRAS-172HFL | Recombinant Full Length Human NRAS Protein, C-Flag-tagged | +Inquiry |
TFF3-16692M | Recombinant Mouse Tff3 protein, His/Fc-tagged | +Inquiry |
SNAPC2-2834H | Recombinant Human SNAPC2, His-tagged | +Inquiry |
AAMP-1542HFL | Recombinant Full Length Human AAMP Protein, C-Flag-tagged | +Inquiry |
RFL3088SF | Recombinant Full Length Sorghum Bicolor Casparian Strip Membrane Protein Sb06G018970 (Sb06G018970) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
MPO-8220H | Native Human Neutrophil Myeloperoxidase | +Inquiry |
APOC3-669H | Native Human APOC3 protein | +Inquiry |
A2m-695R | Native Rat Alpha-2-Macroglobulin | +Inquiry |
Cs-164P | Active Native Porcine Citrate Synthase | +Inquiry |
Luciferase-09F | Active Native Firefly Luciferase | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDC34-7660HCL | Recombinant Human CDC34 293 Cell Lysate | +Inquiry |
GABRE-6059HCL | Recombinant Human GABRE 293 Cell Lysate | +Inquiry |
METTL5-1083HCL | Recombinant Human METTL5 cell lysate | +Inquiry |
TNFRSF10D-2459HCL | Recombinant Human TNFRSF10D cell lysate | +Inquiry |
CYP2A13-433HCL | Recombinant Human CYP2A13 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BpOF4_11355 Products
Required fields are marked with *
My Review for All BpOF4_11355 Products
Required fields are marked with *
0
Inquiry Basket