Recombinant Full Length Human AAMP Protein, C-Flag-tagged
Cat.No. : | AAMP-1542HFL |
Product Overview : | Recombinant Full Length Human AAMP Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The gene is a member of the immunoglobulin superfamily. The encoded protein is associated with angiogenesis, with potential roles in endothelial tube formation and the migration of endothelial cells. It may also regulate smooth muscle cell migration via the RhoA pathway. The encoded protein can bind to heparin and may mediate heparin-sensitive cell adhesion. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 46.6 kDa |
AA Sequence : | MESESESGAAADTPPLETLSFHGDEEIIEVVELDPGPPDPDDLAQEMEDVDFEEEEEEEGNEEGWVLEPQ EGVVGSMEGPDDSEVTFALHSASVFCVSLDPKTNTLAVTGGEDDKAFVWRLSDGELLFECAGHKDSVTCA GFSHDSTLVATGDMSGLLKVWQVDTKEEVWSFEAGDLEWMEWHPRAPVLLAGTADGNTWMWKVPNGDCKT FQGPNCPATCGRVLPDGKRAVVGYEDGTIRIWDLKQGSPIHVLKGTEGHQGPLTCVAANQDGSLILTGSV DCQAKLVSATTGKVVGVFRPETVASQPSLGEGEESESNSVESLGFCSVMPLAAVGYLDGTLAIYDLATQT LRHQCQHQSGIVQLLWEAGTAVVYTCSLDGIVRLWDARTGRLLTDYRGHTAEILDFALSKDASLVVTTSG DHKAKVFCVQRPDRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | AAMP angio associated migratory cell protein [ Homo sapiens (human) ] |
Official Symbol | AAMP |
Synonyms | angio-associated; migratory cell protein |
Gene ID | 14 |
mRNA Refseq | NM_001087.5 |
Protein Refseq | NP_001078.2 |
MIM | 603488 |
UniProt ID | Q13685 |
◆ Recombinant Proteins | ||
AAMP-474H | Recombinant Human AAMP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
AAMP-3580C | Recombinant Chicken AAMP | +Inquiry |
AAMP-173R | Recombinant Rhesus monkey AAMP Protein, His-tagged | +Inquiry |
AAMP-751HF | Recombinant Full Length Human AAMP Protein, GST-tagged | +Inquiry |
AAMP-2R | Recombinant Rhesus Macaque AAMP Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AAMP-9157HCL | Recombinant Human AAMP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AAMP Products
Required fields are marked with *
My Review for All AAMP Products
Required fields are marked with *
0
Inquiry Basket