Recombinant Full Length Solanum Bulbocastanum Photosystem Ii Cp47 Chlorophyll Apoprotein(Psbb) Protein, His-Tagged
Cat.No. : | RFL17633SF |
Product Overview : | Recombinant Full Length Solanum bulbocastanum Photosystem II CP47 chlorophyll apoprotein(psbB) Protein (Q2MIG2) (1-508aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Solanum bulbocastanum (Wild potato) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-508) |
Form : | Lyophilized powder |
AA Sequence : | MGLPWYRVHTVVLNDPGRLLSVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSITGGTVTNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQP VNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSAGLAENQSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPIFRDKEGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTKRQAA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbB |
Synonyms | psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47 |
UniProt ID | Q2MIG2 |
◆ Recombinant Proteins | ||
Slirp-5943M | Recombinant Mouse Slirp Protein, Myc/DDK-tagged | +Inquiry |
DARPP32-11830H | Recombinant Human DARPP32, GST-tagged | +Inquiry |
DNM2-21H | Recombinant Human DNM2 Protein | +Inquiry |
IL17B-316H | Active Recombinant Human interleukin 17B, HIgG1 Fc-tagged, mutant | +Inquiry |
C1orf104-10447H | Recombinant Human C1orf104, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Plasmin-250H | Active Native Human Plasmin | +Inquiry |
MARCKS-12B | Native Bovine MARCKS protein | +Inquiry |
CII-250C | Native Chicken CII | +Inquiry |
VTN -33B | Native Bovine multimeric vitronectin | +Inquiry |
H3N2-02I | Active Native IAV H3N2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RASL12-2500HCL | Recombinant Human RASL12 293 Cell Lysate | +Inquiry |
PSMC1-2765HCL | Recombinant Human PSMC1 293 Cell Lysate | +Inquiry |
WBP2-366HCL | Recombinant Human WBP2 293 Cell Lysate | +Inquiry |
METAP2-457MCL | Recombinant Mouse METAP2 cell lysate | +Inquiry |
TRIM46-1828HCL | Recombinant Human TRIM46 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbB Products
Required fields are marked with *
My Review for All psbB Products
Required fields are marked with *
0
Inquiry Basket