Recombinant Full Length Pinus Koraiensis Photosystem Ii Cp47 Chlorophyll Apoprotein(Psbb) Protein, His-Tagged
Cat.No. : | RFL17475PF |
Product Overview : | Recombinant Full Length Pinus koraiensis Photosystem II CP47 chlorophyll apoprotein(psbB) Protein (Q85X12) (1-508aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pinus koraiensis (Korean pine) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-508) |
Form : | Lyophilized powder |
AA Sequence : | MGLPWYRVHTVVLNDPGRLISVHIMHTALVAGWAGSMTLYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGIKDSWSGWNITGETVINPGIWSYEGVAGAHIMFSGLMFLAAIWHWVYWDL EIFYDERTGKLCLDLPKVFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKIQP VDPAWGAEGFDPFVPGGIASHHIAAGILGILAGLFHLSVRPPQRLYVGLRMGNIETVLSS SIAAVFFAAFIVAGTMWYGSATTPVELFGPTRYQWDQGYFQQEIDRRVRAGLAENLSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGAMDNGDGIAVGWLGHPIFKDKEGNELFVRRMP TFFETFPVVLVDKEGIVKADVPFRRAESKYSVEQVGVTVEFYGGGLDRVSFGDPAIVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHATFALLFFSGHIWHGARTLFRDVFA GIDPDLDSRIEFGAFQKLGDPTTKRQVV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbB |
Synonyms | psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47 |
UniProt ID | Q85X12 |
◆ Recombinant Proteins | ||
GSDMC-3953M | Recombinant Mouse GSDMC Protein, His (Fc)-Avi-tagged | +Inquiry |
MYCBP2-3015H | Recombinant Human MYCBP2 protein, His-tagged | +Inquiry |
RFL11294MF | Recombinant Full Length Mouse Caax Prenyl Protease 2(Rce1) Protein, His-Tagged | +Inquiry |
RFL35155RF | Recombinant Full Length Rickettsia Rickettsii Protein Translocase Subunit Secf(Secf) Protein, His-Tagged | +Inquiry |
APCDD1L-1395HF | Recombinant Full Length Human APCDD1L Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
CKMM-382H | Native Human Creatine Kinase MM (CK-MM) | +Inquiry |
PGC-132H | Native Human Pepsinogen II | +Inquiry |
Collagen-317B | Native Bovine Collagen Type I | +Inquiry |
Ferritin-024B | Native Bovine Ferritin Protein, holo form | +Inquiry |
Complement C3a-46H | Native Human Complement C3a | +Inquiry |
◆ Cell & Tissue Lysates | ||
DMRTB1-489HCL | Recombinant Human DMRTB1 cell lysate | +Inquiry |
ZNF697-2078HCL | Recombinant Human ZNF697 cell lysate | +Inquiry |
NACA-2129HCL | Recombinant Human NACA cell lysate | +Inquiry |
HILPDA-322HCL | Recombinant Human HILPDA lysate | +Inquiry |
Brain-824M | Mini pig Brain Membrane Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbB Products
Required fields are marked with *
My Review for All psbB Products
Required fields are marked with *
0
Inquiry Basket