Recombinant Full Length Adiantum Capillus-Veneris Photosystem Ii Cp47 Chlorophyll Apoprotein(Psbb) Protein, His-Tagged
Cat.No. : | RFL28526AF |
Product Overview : | Recombinant Full Length Adiantum capillus-veneris Photosystem II CP47 chlorophyll apoprotein(psbB) Protein (Q85FJ7) (1-508aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Adiantum capillus-veneris |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-508) |
Form : | Lyophilized powder |
AA Sequence : | MGLPWYRVHTVVLNDPGRLISVHLMHTALVSGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRIGVSKSWGGWIITGDTSTDAGIWSYEGVAAAHIILSGLLFLAAIWHWVYWDL DLFRDDRTGKPSLDLPKIFGIHLFLSGVLCFSFGAFHVTGLFGPGIWISDPYGLTGKVEP VDPAWGAEGFDPFIPGGIASHHIAAGVLGILAGLFHLSVRPPQRLYKALRMGNVETVLSS SIAAVFFAAFVVSGTMWYGSAATPIELFGPTRYQWDQGYFQQEIERRIRLGEAENLSLSQ VWSKIPEKLAFYDYIGNNPAKGGLFRAGAMDNGDGIAVGWLGHALFKDREGRELFVRRMP TFFETFPVVLVDGEGVVRADVPFRRAESKYSVEQVGVTVDFFGGELDGASFSDPATVKKY ARRAQLGEIFEFDRATLKSDGVFRSSPRGWFTFGHTTFALIFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPSTKKQAV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbB |
Synonyms | psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47 |
UniProt ID | Q85FJ7 |
◆ Recombinant Proteins | ||
GAS2-4326C | Recombinant Chicken GAS2 | +Inquiry |
NLGN1-6710HF | Recombinant Full Length Human NLGN1 Protein, GST-tagged | +Inquiry |
MTM1-3471R | Recombinant Rat MTM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
AYP1020-RS10420-4809S | Recombinant Staphylococcus capitis subsp. capitis (strain: AYP1020, sub-species: capitis) AYP1020_RS10420 protein, His-tagged | +Inquiry |
PUCC-1789B | Recombinant Bacillus subtilis PUCC protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Skeletal Muscles-012H | Human Skeletal Muscles Lysate, Total Protein | +Inquiry |
ORM1-26392TH | Native Human ORM1 | +Inquiry |
Lectin-1729G | Active Native Griffonia Simplicifolia Lectin I Protein, Rhodamine labeled | +Inquiry |
Lectin-1785G | Active Native Griffonia Simplicifolia Lectin I isolectin B4 Protein, Fluorescein labeled | +Inquiry |
Collagen-44H | Native Human Collagen I | +Inquiry |
◆ Cell & Tissue Lysates | ||
HMGCR-802HCL | Recombinant Human HMGCR cell lysate | +Inquiry |
SEC23IP-1992HCL | Recombinant Human SEC23IP 293 Cell Lysate | +Inquiry |
CD63-1553SCL | Recombinant Sus scrofa (Pig) CD63 cell lysate | +Inquiry |
BCL2A1-59HCL | Recombinant Human BCL2A1 lysate | +Inquiry |
Testis-515R | Rat Testis Membrane Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbB Products
Required fields are marked with *
My Review for All psbB Products
Required fields are marked with *
0
Inquiry Basket