Recombinant Full Length Arabidopsis Thaliana Putative Glucuronosyltransferase Pgsip7(Pgsip7) Protein, His-Tagged
Cat.No. : | RFL33172AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Putative glucuronosyltransferase PGSIP7(PGSIP7) Protein (F4JMI5) (1-494aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-494) |
Form : | Lyophilized powder |
AA Sequence : | MDLQRTLMFSCWVLSLLIIKTTAYNEKQLFQPLETENANAMTAVMERGLKTQRRPEHKNA YATMMYMGTPRDYEFYVATRVLIRSLKSLHVDADIVVIASLDVPINWIHALEEEDGAKVV RVENLENPYKKQTNFDNRFKLSLNKLYAWSLSDYDRVVMLDVDNLFLKNTDELFQCGQFC AVFINPCIFHTGLFVLQPSMEVFRDMLHELEVKRDNPDGADQGFLVSYFSDLLNQPLFRP PPDNRTALKGHFRLPLGYQMDASYYYLKLRWNVPCGPNSVITFPGAVWLKPWYWWSWPVL PLGLSWHHQRRYTISYSAEMPWVLTQAVFYLGIILVTRLARPNMTKLCYRRSDKNLSMIQ TAFKFVALLFILSAYIIPFFIIPQTIHPLIGWSLYLTGSFALSTIPINAFLLPILPVITP WLGIFGTLLVMAFPSYPDGVVRALSVFGYAFCCAPFLWVSFVKITSHLQIMIDKEVLFPR LGESGVTSGLSKLY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PGSIP7 |
Synonyms | PGSIP7; At4g16600; dl4325w; FCAALL.404; Putative glucuronosyltransferase PGSIP7; Glycogenin-like protein 7; Plant glycogenin-like starch initiation protein 7 |
UniProt ID | F4JMI5 |
◆ Recombinant Proteins | ||
HOXD13A-8781Z | Recombinant Zebrafish HOXD13A | +Inquiry |
PCP4-3485H | Recombinant Human PCP4 protein, His-tagged | +Inquiry |
EIF2C2-12358H | Recombinant Human EIF2C2, His-tagged | +Inquiry |
CAV1-0389H | Active Recombinant Human CAV1 Full Length Transmembrane protein(Nanodisc) | +Inquiry |
DHX9-12H | Active Recombinant Human DHX9 Protein, His tagged | +Inquiry |
◆ Native Proteins | ||
RB5200-3281H | Native Human RB5200 | +Inquiry |
Lectin-1759C | Active Native Canavalia ensiformis Concanavalin A Protein, Fluorescein Labeled | +Inquiry |
CEACAM5-27803TH | Native Human CEACAM5 | +Inquiry |
FBa-12H | Native Human Factor Ba protein | +Inquiry |
FSH-1564H | Active Native Human Follicle Stimulating Hormone | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTN-1524MCL | Recombinant Mouse PTN cell lysate | +Inquiry |
SSR1-1459HCL | Recombinant Human SSR1 293 Cell Lysate | +Inquiry |
SCTR-1573HCL | Recombinant Human SCTR cell lysate | +Inquiry |
NDST3-3927HCL | Recombinant Human NDST3 293 Cell Lysate | +Inquiry |
HA-2262ICL | Recombinant Influenza B HA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All PGSIP7 Products
Required fields are marked with *
My Review for All PGSIP7 Products
Required fields are marked with *
0
Inquiry Basket