Recombinant Full Length Arabidopsis Thaliana Probable Xyloglucan Glycosyltransferase 6(Cslc6) Protein, His-Tagged
Cat.No. : | RFL31493AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Probable xyloglucan glycosyltransferase 6(CSLC6) Protein (Q9SRT3) (1-682aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-682) |
Form : | Lyophilized powder |
AA Sequence : | MSRSQNEEFQQWWNKQRDRNNHDVLYAGDDEAFLTVEIRTPATVDPDKDRIRTRTVRQLS RLYLLKFKQLASSFLWIGNSFLYLVRTANRRIANDNPPSVSSSARLYRLIKGFLVVVVLL LCFELAAYFKGWHFTPPSVASAEVAVEVVYAWWLEIRASYLAPPLQSLTNVCIVLFLIQS VDRLVLVLGCFWIKLRRIKPVASMEYPTKLVGEGVRLEDYPMVIVQIPMCNEKEVYQQSI GAVCMLDWPRERMLVQVLDDSSELDVQQLIKAEVQKWQQRGVRIVYRHRLIRTGYKAGNL KAAMNCEYVKDYEFVAIFDADFQPPADFLKKTVPHFKGNEELALVQTRWAFVNKDENLLT RLQNINLSFHFEVEQQVNGVFINFFGFNGTAGVWRIKALEDCGGWLERTTVEDMDIAVRA HLCGWKFIYLNDVKCLCELPESYEAYKKQQYRWHSGPMQLFRLCFFDILRSKVSAAKKAN MIFLFFLLRKLILPFYSFTLFCVILPLTMFFPEANLPSWVVCYIPGIMSILNIIPAPRSF PFIVPYLLFENTMSVTKFGAMISGLFKFDSSYEWVVTKKLGRSSEADLVAYAESGSLVES TTIQRSSSDSGLTELSKLGAAKKAGKTKRNRLYRTEIALAFILLAASVRSLLSAQGIHFY FLLFQGITFVIVGLDLIGEQVS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CSLC6 |
Synonyms | CSLC6; At3g07330; F21O3.4; Probable xyloglucan glycosyltransferase 6; Cellulose synthase-like protein C6; AtCslC6 |
UniProt ID | Q9SRT3 |
◆ Recombinant Proteins | ||
PGLYRP1-732H | Recombinant Human PGLYRP1 Protein, his-tagged | +Inquiry |
Traf5-6620M | Recombinant Mouse Traf5 Protein, Myc/DDK-tagged | +Inquiry |
EFNA5-993C | Active Recombinant Canine EFNA5 protein, Fc-tagged | +Inquiry |
RABGGTB-301145H | Recombinant Human RABGGTB protein, GST-tagged | +Inquiry |
BDNF-1696HF | Recombinant Full Length Human BDNF Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Collagen-121H | Native Human Collagen Type IV protein | +Inquiry |
Spleen-006H | Human Spleen Lysate, Total Protein | +Inquiry |
S-52H | Native Human Protein S | +Inquiry |
IgG-150G | Native Goat IgG Fab fragment | +Inquiry |
AMY1A-5313H | Native Human Amylase, Alpha 1A (salivary) | +Inquiry |
◆ Cell & Tissue Lysates | ||
Salivary-570M | MiniPig Salivary Lysate, Total Protein | +Inquiry |
RBMS1-2462HCL | Recombinant Human RBMS1 293 Cell Lysate | +Inquiry |
CPSF7-7301HCL | Recombinant Human CPSF7 293 Cell Lysate | +Inquiry |
YAE1D1-7967HCL | Recombinant Human C7orf36 293 Cell Lysate | +Inquiry |
SERPINB6-553HCL | Recombinant Human SERPINB6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All CSLC6 Products
Required fields are marked with *
My Review for All CSLC6 Products
Required fields are marked with *
0
Inquiry Basket