Recombinant Human RABGGTB protein, GST-tagged

Source :	E. coli
Species :	Human
Tag :	GST
Form :	The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Protein length :	Met1-Ser331
AA Sequence :	MGTPQKDVIIKSDAPDTLLLEKHADYIASYGSKKDDYEYCMSEYLRMSGIYWGLTVMDLMGQLHRMNREEILAFIKSCQHECGGISASIGHDPHLLYTLSAVQILTLYDSINVIDVNKVVEYVKGLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRNFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVNPVFCMPEEVLQRVNVQPELVS
Purity :	90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability :	Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage :	Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Name	RABGGTB Rab geranylgeranyltransferase, beta subunit [ Homo sapiens ]
Official Symbol	RABGGTB
Synonyms	RABGGTB; Rab geranylgeranyltransferase, beta subunit; geranylgeranyl transferase type-2 subunit beta; GGTase-II-beta; rab GGTase beta; rab GG transferase beta; rab geranylgeranyltransferase subunit beta; rab geranyl-geranyltransferase subunit beta; geranylgeranyl transferase type II subunit beta; type II protein geranyl-geranyltransferase subunit beta; GGTB;
Gene ID	5876
mRNA Refseq	NM_004582
Protein Refseq	NP_004573
MIM	179080
UniProt ID	P53611