Recombinant Full Length Arabidopsis Thaliana Probable S-Acyltransferase At5G50020(At5G50020) Protein, His-Tagged
Cat.No. : | RFL3995AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Probable S-acyltransferase At5g50020(At5g50020) Protein (Q8VYS8) (1-407aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-407) |
Form : | Lyophilized powder |
AA Sequence : | MAGRVFEAWKGSNKFLFGGRLIFGPDAWSIPFTFLLIITPVCFFSVFVATHLRRELLPNN AGHVFLVAGVLFTVFVLILLFLTSARDPGIVPRNSHPPEEELCYDTTVSSDGRQTPTVQI PRTKEVMVYGVSVRVKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWRNYRYFFMFVSS ATILCIYIFSMSALYIKVLMDNHQGTVWRAMRESPWAVMLMIYCFISLWFVGGLTGFHLY LISTNQTTYENFRYRSDNRINVYNRGCSNNFFETFCSKVKPSRNDFRAFIKEEPPRNITL ATTWERPEEADEENREERRQKVEDDLDIDEDVMKLQQRLNDEEGSDTAHHKIDIDQMRIG SNERAPTIRSEARHGNWGARSNAQEEDVIAGSSVRESRSYAAAEEGR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PAT09 |
Synonyms | PAT09; At5g50020; MPF21.3; Probable protein S-acyltransferase 9; Probable palmitoyltransferase At5g50020; Zinc finger DHHC domain-containing protein At5g50020 |
UniProt ID | Q8VYS8 |
◆ Recombinant Proteins | ||
TGFB2-227C | Recombinant Cattle TRIM21 Protein, His-tagged | +Inquiry |
ACTA2-676HFL | Active Recombinant Full Length Human ACTA2 Protein, C-Flag-tagged | +Inquiry |
SE1257-4478S | Recombinant Staphylococcus epidermidis ATCC 12228 SE1257 protein, His-tagged | +Inquiry |
MOV10-1865H | Recombinant Human MOV10 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PRKCA-1301H | Active Recombinant Full Length Human protein kinase C, Alpha, His-tagged | +Inquiry |
◆ Native Proteins | ||
Neuraminidase-013C | Active Native Clostridium perfringens Neuraminidase Agarose, Type VI-A | +Inquiry |
Avidin Biotin-27 | Native Avidin Protein | +Inquiry |
ELANE-3221H | Active Native Human ELANE Protein | +Inquiry |
GlycoProtein G-11H | Native HSV-2 GlycoProtein G | +Inquiry |
Lectin-1777G | Active Native Galanthus Nivalis Lectin Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
Colon Ascending-7H | Human Adult Colon Ascending Membrane Lysate | +Inquiry |
PSTPIP2-1432HCL | Recombinant Human PSTPIP2 cell lysate | +Inquiry |
TERF1-528HCL | Recombinant Human TERF1 cell lysate | +Inquiry |
SDS-2004HCL | Recombinant Human SDS 293 Cell Lysate | +Inquiry |
BEX1-8464HCL | Recombinant Human BEX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PAT09 Products
Required fields are marked with *
My Review for All PAT09 Products
Required fields are marked with *
0
Inquiry Basket