Recombinant Full Length Arabidopsis Thaliana 3-Hydroxy-3-Methylglutaryl-Coenzyme A Reductase 1(Hmg1) Protein, His-Tagged
Cat.No. : | RFL27392AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1(HMG1) Protein (P14891) (1-592aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-592) |
Form : | Lyophilized powder |
AA Sequence : | MDLRRRPPKPPVTNNNNSNGSFRSYQPRTSDDDHRRRATTIAPPPKASDALPLPLYLTNA VFFTLFFSVAYYLLHRWRDKIRYNTPLHVVTITELGAIIALIASFIYLLGFFGIDFVQSF ISRASGDAWDLADTIDDDDHRLVTCSPPTPIVSVAKLPNPEPIVTESLPEEDEEIVKSVI DGVIPSYSLESRLGDCKRAASIRREALQRVTGRSIEGLPLDGFDYESILGQCCEMPVGYI QIPVGIAGPLLLDGYEYSVPMATTEGCLVASTNRGCKAMFISGGATSTVLKDGMTRAPVV RFASARRASELKFFLENPENFDTLAVVFNRSSRFARLQSVKCTIAGKNAYVRFCCSTGDA MGMNMVSKGVQNVLEYLTDDFPDMDVIGISGNFCSDKKPAAVNWIEGRGKSVVCEAVIRG EIVNKVLKTSVAALVELNMLKNLAGSAVAGSLGGFNAHASNIVSAVFIATGQDPAQNVES SQCITMMEAINDGKDIHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGASTESPGMNA RRLATIVAGAVLAGELSLMSAIAAGQLVRSHMKYNRSSRDISGATTTTTTTT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HMG1 |
Synonyms | HMG1; HMGR1; At1g76490; F14G6.9; F15M4.1; 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1; AtHMGR1; HMG-CoA reductase 1 |
UniProt ID | P14891 |
◆ Recombinant Proteins | ||
YKWB-2500B | Recombinant Bacillus subtilis YKWB protein, His-tagged | +Inquiry |
CHPT1-1383R | Recombinant Rat CHPT1 Protein | +Inquiry |
CRIP3-1878H | Recombinant Human CRIP3 Protein, GST-tagged | +Inquiry |
Ddx6-2515M | Recombinant Mouse Ddx6 Protein, Myc/DDK-tagged | +Inquiry |
Comt-829R | Recombinant Rat Comt Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
IgA-244H | Native Horse Immunoglobulin A | +Inquiry |
Acetate Kinase-22B | Active Native Bacillus stearothermophilus Acetate Kinase | +Inquiry |
MuV-03 | Native Mumps/Parotitis Virus Antigen | +Inquiry |
CRP-158R | Native Rabbit C-Reactive Protein | +Inquiry |
NEFH-01P | Native Pig NEFH Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADRM1-8996HCL | Recombinant Human ADRM1 293 Cell Lysate | +Inquiry |
A549-043WCY | Human Lung Adenocarcinoma A549 Whole Cell Lysate | +Inquiry |
GOLGA1-725HCL | Recombinant Human GOLGA1 cell lysate | +Inquiry |
STRA13-1388HCL | Recombinant Human STRA13 293 Cell Lysate | +Inquiry |
CPT2-391HCL | Recombinant Human CPT2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HMG1 Products
Required fields are marked with *
My Review for All HMG1 Products
Required fields are marked with *
0
Inquiry Basket