Recombinant Human CRIP3 Protein, GST-tagged
Cat.No. : | CRIP3-1878H |
Product Overview : | Human CRIP3 full-length ORF ( AAI48847.1, 1 a.a. - 204 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | CRIP3 (Cysteine Rich Protein 3) is a Protein Coding gene. An important paralog of this gene is CRIP2. |
Molecular Mass : | 49.39 kDa |
AA Sequence : | MSWTCPRCQQPVFFAEKVSSLGKNWHRFCLKCERCHSILSPGGHAEHNGRPYCHKPCYGALFGPRGVNIGGVGSYLYNPPTPSPGCTTPLSPSSFSPPRPRTGLPQGKKSPPHMKTFTGETSLCPGCGEPVYFAEKVMSLGRNWHRPCLRCQRCHKTLTAGSHAEHDGVPYCHVPCYGYLFGPKGVNIGDVGCYIYDPVKIKFK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CRIP3 cysteine-rich protein 3 [ Homo sapiens ] |
Official Symbol | CRIP3 |
Synonyms | CRIP3; cysteine-rich protein 3; bA480N24.2; TLP; TLP A; CRP-3; h6LIMo; thymus LIM protein TLP-A; chromosome 6 LIM domain only protein; TLP-A; |
Gene ID | 401262 |
mRNA Refseq | NM_206922 |
Protein Refseq | NP_996805 |
UniProt ID | Q6Q6R5 |
◆ Recombinant Proteins | ||
CRIP3-1878H | Recombinant Human CRIP3 Protein, GST-tagged | +Inquiry |
CRIP3-2733H | Recombinant Human CRIP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
CRIP3-3907M | Recombinant Mouse CRIP3 Protein | +Inquiry |
CRIP3-1977M | Recombinant Mouse CRIP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
CRIP3-2057HF | Recombinant Full Length Human CRIP3 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CRIP3 Products
Required fields are marked with *
My Review for All CRIP3 Products
Required fields are marked with *
0
Inquiry Basket