Recombinant Full Length Agrobacterium Radiobacter Apolipoprotein N-Acyltransferase(Lnt) Protein, His-Tagged
Cat.No. : | RFL33167AF |
Product Overview : | Recombinant Full Length Agrobacterium radiobacter Apolipoprotein N-acyltransferase(lnt) Protein (B9J8B4) (1-533aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Agrobacterium radiobacter |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-533) |
Form : | Lyophilized powder |
AA Sequence : | MERLSGKVILVWGFKRALLAILAGAIGVLALPPFGFFAAMFVSFTLLVWLLDGAAAGPDS GFLGRLWPAFTTGWLFGFGYFVAGLWWLGHALLIDADQFAWALPLAILGLPAFLAIFYGV AAVLARLLWSDGMGRIAALAFGFGLLEWLRSFLFTGFPWNAIGYGAMPIPLMMQSAHVIG VLGVTVLAVFVFAAPALLGTRQGRVPGIGLAVLIAAAHFAYGYYALNLPALPPAAGKAAP VVRIVQPAIDQEAKMDTAADRNAIFDKHLSLSVQPPVNGGKRPDIIVWPETAIPFILTDN QDALTRIADQLDDDQILITGAVRVEDMGPGVEPRYYNSVYVIDGRGQIIGASDKTHLVPF GEYVPFENILGYLGIENVVELPGGFSAAASRQLLTLPDGIKLYPLICYEIIFPNEMTPEI RQADAILNVTNDAWFGDTPGPYQHFLQARVRAVEQGLPLIRSANTGVSAYVDAHGRLISG IDFNEQGFVDSTLSGATVSRIDDSVRKTYFWLIIGIVGMIAVISRMGFISRVN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lnt |
Synonyms | lnt; Arad_0660; Apolipoprotein N-acyltransferase; ALP N-acyltransferase |
UniProt ID | B9J8B4 |
◆ Recombinant Proteins | ||
USP5-4943R | Recombinant Rhesus Macaque USP5 Protein, His (Fc)-Avi-tagged | +Inquiry |
CTPS2-1659R | Recombinant Rat CTPS2 Protein | +Inquiry |
CAPN13-308H | Recombinant Human CAPN13 Protein, MYC/DDK-tagged | +Inquiry |
TNFRSF9-315H | Recombinant Human TNFRSF9 Protein (ECD), Fc-His-tagged(C-ter) | +Inquiry |
RO60-5476H | Recombinant Human RO60 Protein (full-length), C-His tagged | +Inquiry |
◆ Native Proteins | ||
PRTN3-243H | Native Human PRTN3 Protein | +Inquiry |
TTR-31108TH | Native Human TTR | +Inquiry |
APOC3-27333TH | Native Human APOC3 | +Inquiry |
R-PE-004R | Native Red Fluorescent Protein | +Inquiry |
KLH-82 | Native Hemocyanin-Keyhole Limpet (KLH) subunits | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARL10-8723HCL | Recombinant Human ARL10 293 Cell Lysate | +Inquiry |
BOP1-8418HCL | Recombinant Human BOP1 293 Cell Lysate | +Inquiry |
COQ6-192HCL | Recombinant Human COQ6 lysate | +Inquiry |
GNG11-5856HCL | Recombinant Human GNG11 293 Cell Lysate | +Inquiry |
KIR2DL3-1840HCL | Recombinant Human KIR2DL3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All lnt Products
Required fields are marked with *
My Review for All lnt Products
Required fields are marked with *
0
Inquiry Basket