Recombinant Cynomolgus monkey APOC3 protein, MBP&His-tagged
Cat.No. : | APOC3-2198C |
Product Overview : | Recombinant Cynomolgus monkey APOC3 protein(P18659)(21-99aa), fused to N-terminal MBP tag and C-terminal His tag, was expressed in Insect Cell. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cynomolgus |
Source : | Insect Cells |
Tag : | His&MBP |
Protein Length : | 21-99aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 52.7 kDa |
AA Sequence : | SEAEDTSLLGFMQGYMQHATKTAKDALTSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKLSGFWDLNPEAKPTLAEAA |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
◆ Recombinant Proteins | ||
APOC3-362H | Recombinant Human APOC3 protein | +Inquiry |
Apoc3-1939M | Recombinant Mouse Apoc3 protein, His-tagged | +Inquiry |
APOC3-1128HF | Recombinant Full Length Human APOC3 Protein, GST-tagged | +Inquiry |
APOC3-2198C | Recombinant Cynomolgus monkey APOC3 protein, MBP&His-tagged | +Inquiry |
APOC3-1789M | Recombinant Mouse APOC3 Protein | +Inquiry |
◆ Native Proteins | ||
APOC3-8040H | Native Human ApoLipoprotein CIII | +Inquiry |
APOC3-669H | Native Human APOC3 protein | +Inquiry |
APOC3-27333TH | Native Human APOC3 | +Inquiry |
ApoC-III-3559H | Native Human ApoC-III | +Inquiry |
APOC3-361H | Native Human Apolipoprotein C-III | +Inquiry |
◆ Cell & Tissue Lysates | ||
APOC3-8782HCL | Recombinant Human APOC3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All APOC3 Products
Required fields are marked with *
My Review for All APOC3 Products
Required fields are marked with *
0
Inquiry Basket