Recombinant Chicken KITLG Protein
Cat.No. : | KITLG-39C |
Product Overview : | The Chicken SCF recombinant protein without tag was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chicken |
Source : | Yeast |
Molecular Mass : | 22.5 kDa |
AA Sequence : | QSSCGNPVTDDVNDIAKLVGNLPNDYLITLKYVPKMDSLPNHCWLHLMVPEFSRSLHNLLQKFSDISDMSDVLSNYSIINNLTRIINDLMACLAFDKNKDFIKENGHLYEEDRFIPENFFRLFNSTIEVYKEFADSLDKNDCIMPSTVETPENDSRVAVTKTISFPPVAASSLRNDSIGSNTSSNSNKEALGFISSSSLQ |
Applications : | The Chicken SCF endotoxin-free recombinant protein can be used in cell culture, as an SCF ELISA Standard, and as a Western Blot Control. |
Gene Name | KITLG KIT ligand [ Gallus gallus (chicken) ] |
Official Symbol | KITLG |
Synonyms | KITLG; KIT ligand; kit ligand; C-kit ligand; KIT ligand precursor form 1; KIT ligand precursor form 4; MGF; SCF; mast cell growth factor; stem cell factor; EC 3.2.1.31 |
Gene ID | 396028 |
mRNA Refseq | NM_205130 |
Protein Refseq | NP_990461 |
UniProt ID | https://www.uniprot.org/uniprot/Q09108 |
◆ Recombinant Proteins | ||
Kitl-042E | Active Recombinant Mouse Kitl (26-189aa) | +Inquiry |
KITL-526M | Recombinant Mouse KITL Protein | +Inquiry |
KITLG-1245H | Recombinant Human KIT Ligand | +Inquiry |
KITLG-3136H | Recombinant Human KITLG protein, GST-tagged | +Inquiry |
KITLG-235H | Recombinant Human KITLG Protein, Mature chain, Tag Free, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
KITLG-571HCL | Recombinant Human KITLG cell lysate | +Inquiry |
KITLG-583MCL | Recombinant Mouse KITLG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KITLG Products
Required fields are marked with *
My Review for All KITLG Products
Required fields are marked with *
0
Inquiry Basket