Recombinant Mouse KITL Protein

• Cat.No.: KITL-526M
• Product Overview: Recombinant Mouse KITL protein

Specification

• Description: Enables cytokine activity and stem cell factor receptor binding activity. Acts upstream of or within several processes, including positive regulation of cell differentiation; positive regulation of cell population proliferation; and positive regulation of protein phosphorylation. Located in extracellular space and plasma membrane. Is integral component of membrane. Is expressed in several structures, including alimentary system; central nervous system; genitourinary system; integumental system; and sensory organ. Human ortholog(s) of this gene implicated in autosomal dominant nonsyndromic deafness 69 and familial progressive hyperpigmentation with or without hypopigmentation. Orthologous to human KITLG (KIT ligand).
• Species: Mouse
• Form: Lyophilized
• Protein length: 273
• AA Sequence: MKKTQTWIITCIYLQLLLFNPLVKTKEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAAKAPEDSGLQWTAMALPALISLVIGFAFGALYWKKKQSSLTRAVENIQINEEDNEISMLQQKEREFQEV
• Purity: > 98%
• Applications: WB; ELISA; FACS; FC
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: At -20 centigrade.
• Storage Buffer: PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: Kitl kit ligand [ Mus musculus (house mouse) ]
• Official Symbol: KITL
• Synonyms: Kitl; kit ligand; Gb; SF; Sl; Clo; Con; Mgf; SCF; SLF; blz; Kitlg; contrasted; kit ligand; C-kit ligand; Steel factor; cloud gray; grizzle-belly; hematopoietic growth factor KL; mast cell growth factor; stem cell factor; EC 3.2.1.31
• Gene ID: 17311
• mRNA Refseq: NM_013598
• Protein Refseq: NP_038626
• UniProt ID: P20826