Recombinant Human KITLG protein, GST-tagged
Cat.No. : | KITLG-3136H |
Product Overview : | Recombinant Human KITLG protein(P21583)(26-189aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 26-189aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 45.5 kDa |
AA Sequence : | EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | KITLG KIT ligand [ Homo sapiens ] |
Official Symbol | KITLG |
Synonyms | KITLG; KIT ligand; MGF; kit ligand; familial progressive hyperpigmentation 2; FPH2; Kitl; KL 1; mast cell growth factor; SCF; SF; steel factor; stem cell factor; c-Kit ligand; KL-1; SHEP7; kit-ligand; DKFZp686F2250; |
Gene ID | 4254 |
mRNA Refseq | NM_000899 |
Protein Refseq | NP_000890 |
MIM | 184745 |
UniProt ID | P21583 |
◆ Recombinant Proteins | ||
KITLG-2056H | Recombinant Human KITLG Protein, His-tagged | +Inquiry |
Kitl-3697M | Active Recombinant Mouse Kitl Protein | +Inquiry |
Kitl-1713M | Recombinant Mouse Kitl Protein, His-tagged | +Inquiry |
Kitl-198M | Active Recombinant Mouse Kitl Protein | +Inquiry |
Kitl-61M | Recombinant Mouse Kit Ligand | +Inquiry |
◆ Cell & Tissue Lysates | ||
KITLG-583MCL | Recombinant Mouse KITLG cell lysate | +Inquiry |
KITLG-571HCL | Recombinant Human KITLG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KITLG Products
Required fields are marked with *
My Review for All KITLG Products
Required fields are marked with *
0
Inquiry Basket