Recombinant Bovine PRNP Protein

Cat.No. : PRNP-290B
Product Overview : Recombinant Bovine PRNP(24-241 aa) was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Bovine
Source : E.coli
Tag : Non
Protein Length : 24-241 aa
Description : Prion Protein (PrP) is an abundant cellular protein in mammalian neural tissue. It is associated with mammalian prion diseases, e.g. transmissible spongiforme encephalophathies that include human Creutzfeld-Jakob disease, bovine spongiforme encephalopathy, sheep scrapie, cervid’s chronic wasting disease and various rodent prion diseases. In the disease process, PrP undergoes protein aggregation into disease specific PrPSc.
Form : Finally dialysed in pure water, shock frozen in liquid nitrogen at a protein concentration of 0.25 mg/ml.
Molecular Mass : 23163 kg/mol
AA Sequence : GSKKRPKPGGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGGWGQGGTHGQWNKPSKPKTNMKHVAGAAAAGAVVGGLGGYMLGSAMSRP
LIHFGSDYEDRYYRENMHRYPNQVYYRPVDQYSNQNNFVHDCVNITVKEHTVTTTTKGENFTETDIKMMERVVEQMCITQYQRESQAYYQRGA
Purity : > 95% by SDS-PAGE
Applications : Prion Protein is frequently used in analytical aggregation assays
Notes : Thawing: Gentle agitation at 37 centigrade until no ice is left. Keep on ice. Do not refreeze
Storage : Store at -80 centigrade
Concentration : 0.25 mg/ml
Gene Name PRNP prion protein [ Bos taurus ]
Official Symbol PRNP
Synonyms PrP; AltPrP; prion protein precursor PrP; prion protein variant a; prion protein variant b
Gene ID 281427
mRNA Refseq NM_001271625
Protein Refseq NP_001258554
UniProt ID F7VJQ2

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PRNP Products

Required fields are marked with *

My Review for All PRNP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon