Active Recombinant Swine IL-6
Cat.No. : | IL6-29S |
Product Overview : | Swine IL-6 was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pig |
Source : | Yeast |
Tag : | Non |
Description : | Interleukin-6 (IL-6) is an interleukin that acts as both a pro-inflammatory and anti-inflammatory cytokine. It is secreted by T cells and macrophages to stimulate immune response to trauma, especially burns or other tissue damage leading to inflammation. IL-6 is also produced from muscle, and is elevated in response to muscle contraction. It is significantly elevated with exercise, and precedes the appearance of other cytokines in the circulation. Osteoblasts secrete IL-6 to stimulate osteoclast formation. Smooth muscle cells in the tunica media of many blood vessels also produce IL-6 as a pro-inflammatory cytokine. The role of IL-6 as an anti-inflammatory cytokine is mediated through its inhibitory effects on TNF-alpha and IL-1, and activation of IL-1ra and IL-10. |
Form : | Lyophilized |
Bio-activity : | The biological activity of recombinant swine IL-6 was measured in a cell proliferation assay using the mouse B9 cell line. The ED50 for this effect is typically 1-10 pg/mL. |
Molecular Mass : | 20.9 kDa |
AA Sequence : | GRLEEDAKGDATSDKMLFTSPDKTEELIKYILGKISAMRKEMCEKYEKCENSKEVLAENNLNLPKMAEKDGCFQSGFNQETCLMRITTGLVEFQIYLDYLQKEYESNKGNVEAVQISTKALIQTLRQKGKNPDKATTPNPTTNAGLLDKLQSQNEWMKNTKIILILRSLEDFLQFSLRAIRIM (183) |
Applications : | The Swine IL-6 protein can be used in cell culture, as an IL-6 ELISA Standard, and as a Western Blot Control. |
Storage : | -20 C |
◆ Recombinant Proteins | ||
ADAT3-2854H | Recombinant Human ADAT3 protein, His-tagged | +Inquiry |
IL6-4372R | Recombinant Rabbit IL6 Protein | +Inquiry |
IL6-236I | Active Recombinant Human IL6 Protein | +Inquiry |
IL6-29S | Active Recombinant Swine IL-6 | +Inquiry |
Il6-321M | Active Recombinant Mouse Il6, Fc-tagged | +Inquiry |
◆ Native Proteins | ||
IL6-01SFL | Recombinant Full Length Sheep IL6 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL6-5224HCL | Recombinant Human IL6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL6 Products
Required fields are marked with *
My Review for All IL6 Products
Required fields are marked with *
0
Inquiry Basket