Active Recombinant Human IL6 Protein
Cat.No. : | IL6-236I |
Product Overview : | Recombinant Human IL6 Protein without tag was expressed in CHO. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | CHO |
Description : | Interleukin-6 (IL-6), also known as BSF-2, CDF and IFNB2, is a pleiotropic cytokine that acts in both pro-inflammatory and anti-inflammatory responses. It is produced mainly by T cells, macrophages, monocytes, endothelial cells and muscle cells. IL-6 binds to IL-6 receptor (IL-6R) to trigger the association of IL-6R with gp130, inducing signal transduction through JAKs and STATs. The biological functions of IL-6 are diverse. It stimulates B cell differentiation and antibody production, myeloma and plasmacytoma growth, as well as nerve cell differentiation. It also acts as a myokine, produced by muscle cells in response to muscle contraction, to be released to the blood stream to help break down fats and improve insulin resistance. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 0.06 ng/mL, measured in a cell proliferation assay using 7TD1 cells. |
Molecular Mass : | 21-23 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | PVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE. |
Storage : | Lyophilized recombinant Human Interleukin-6 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human Interleukin-6 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | IL6 interleukin 6 (interferon, beta 2) [ Homo sapiens ] |
Official Symbol | IL6 |
Synonyms | IL6; interleukin 6 (interferon, beta 2); IFNB2; interleukin-6; BSF2; HGF; HSF; IL 6; CDF; BSF-2; IFN-beta-2; interferon beta-2; interleukin BSF-2; hybridoma growth factor; CTL differentiation factor; B-cell stimulatory factor 2; B-cell differentiation factor; IL-6; |
Gene ID | 3569 |
mRNA Refseq | NM_000600 |
Protein Refseq | NP_000591 |
MIM | 147620 |
UniProt ID | P05231 |
◆ Recombinant Proteins | ||
Il6-183M | Recombinant Mouse interleukin 6 Protein, Tag Free | +Inquiry |
Il6-113M | Active Recombinant Mouse Il6 Protein | +Inquiry |
IL6-313H | Active Recombinant Human IL6, HIgG1 Fc-tagged | +Inquiry |
IL6-185M | Active Recombinant Mouse IL6 Protein | +Inquiry |
IL6-093I | Active Recombinant Human IL6 Protein (184 aa) | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL6-5224HCL | Recombinant Human IL6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL6 Products
Required fields are marked with *
My Review for All IL6 Products
Required fields are marked with *
0
Inquiry Basket