Active Recombinant Human IL6 Protein

• Cat.No.: IL6-236I
• Product Overview: Recombinant Human IL6 Protein without tag was expressed in CHO.

Specification

• Species: Human
• Source: CHO
• Description: Interleukin-6 (IL-6), also known as BSF-2, CDF and IFNB2, is a pleiotropic cytokine that acts in both pro-inflammatory and anti-inflammatory responses. It is produced mainly by T cells, macrophages, monocytes, endothelial cells and muscle cells. IL-6 binds to IL-6 receptor (IL-6R) to trigger the association of IL-6R with gp130, inducing signal transduction through JAKs and STATs. The biological functions of IL-6 are diverse. It stimulates B cell differentiation and antibody production, myeloma and plasmacytoma growth, as well as nerve cell differentiation. It also acts as a myokine, produced by muscle cells in response to muscle contraction, to be released to the blood stream to help break down fats and improve insulin resistance.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 0.06 ng/mL, measured in a cell proliferation assay using 7TD1 cells.
• Molecular Mass: 21-23 kDa, observed by reducing SDS-PAGE.
• AA Sequence: PVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE.
• Storage: Lyophilized recombinant Human Interleukin-6 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human Interleukin-6 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: IL6 interleukin 6 (interferon, beta 2) [ Homo sapiens ]
• Official Symbol: IL6
• Synonyms: IL6; interleukin 6 (interferon, beta 2); IFNB2; interleukin-6; BSF2; HGF; HSF; IL 6; CDF; BSF-2; IFN-beta-2; interferon beta-2; interleukin BSF-2; hybridoma growth factor; CTL differentiation factor; B-cell stimulatory factor 2; B-cell differentiation factor; IL-6
• Gene ID: 3569
• mRNA Refseq: NM_000600
• Protein Refseq: NP_000591
• MIM: 147620
• UniProt ID: P05231