Recombinant Full Length Sheep IL6 Protein

• Cat.No.: IL6-01SFL
• Product Overview: Recombinant Sheep IL6 Protein without tag was expressed in yeast.

Specification

• Species: Sheep
• Source: Yeast
• Tag: Non
• Description: IL-6 acts as both a pro-inflammatory and anti-inflammatory cytokine. It is secreted by T cells and macrophages to stimulate immune response to trauma, especially burns or other tissue damage leading to inflammation. IL-6 is also produced from muscle, and is elevated in response to muscle contraction. It is significantly elevated with exercise, and precedes the appearance of other cytokines in the circulation. Osteoblasts secrete IL-6 to stimulate osteoclast formation. Smooth muscle cells in the tunica media of many blood vessels also produce IL-6 as a pro-inflammatory cytokine. The role of IL-6 as an anti-inflammatory cytokine is mediated through its inhibitory effects on TNF-alpha and IL-1, and activation of IL-1ra and IL-10.
• Molecular Mass: 20.4 kDa
• Purity: > 98% as visualized by SDS-PAGE analysis
• AA Sequence: GPLGEDFKNDTTPSRLLLTTPEKTEALIKHIVDKISAIRKEICEKNDECENSKETLAENKLKLPKMEEKDGCFQSGFNQAICLIKTTAGLLEYQIYLDFLQNEFEGNQETVMELQSSIRTLIQILKEKIAGLITTPATHTDMLEKMQSSNEWVKNAKVIIILRSLENFLQFSLRAIRMK
• Endotoxin: Naturally endotoxin-free
• Applications: Cell Culture, ELISA Standard, ELISpot Control, Western Blot Control
• Storage: At -20 centigrade

Gene Information

• Gene Name: IL6 interleukin 6 [ Ovis aries (sheep) ]
• Official Symbol: IL6
• Synonyms: IL6; interleukin 6 (interferon, beta 2); interleukin-6; IL-6
• Gene ID: 443406
• mRNA Refseq: NM_001009392
• Protein Refseq: NP_001009392
• UniProt ID: P29455