Species : |
Rat |
Source : |
CHO |
Tag : |
His |
Protein Length : |
174 |
Description : |
Thrombopoietin (TPO), also known as c-Mpl ligand, MGDF and THOP, is a glycoprotein hormone belonging to the EPO/TPO family. It is expressed mainly in the liver, kidney and skeletal muscle. TPO binds and signals through c-Mpl receptor. It stimulates the proliferation and maturation of megakaryocytes from their committed progenitor cells, and it regulates the production and circulation of platelets. TPO has also been reported to promote apoptosis of hypoxia-sensitized neurons and to inhibit neuronal differentiation. |
Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : |
The ED50 as determined by the dose-dependent stimulation of the proliferation of human MO7e cells was found to be ≤ 0.2 ng/mL, corresponding to a specific activity of ≥ 5 6 units/mg. |
Molecular Mass : |
22 kDa, observed by reducing SDS-PAGE. |
AA Sequence : |
SPVPPACDPRLLNKLLRDSYLLHSRLSQCPDVNPLSIPVLLPAVDFSLGEWKTQTEQSKAQDILGAVSLLLEGVMAARGQLEPSCLSSLLGQLSGQVRLLLGALQGLLGTQLPPQGRTTAHKDPSALFLSLQQLLRGKVRFLLLVEGPALCVRRTLPTTAVPSRTSQLLTLNKFHHHHHH |
Endotoxin : |
< 0.2 EU/μg, determined by LAL method. |
Purity : |
> 98% as analyzed by SDS-PAGE. |
Storage : |
Lyophilized recombinant Rat Thrombopoietin remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Rat Thrombopoietin should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : |
Lyophilized after extensive dialysis against PBS. |
Reconstitution : |
Reconstituted in ddH2O or PBS at 100 μg/mL. |