Active Recombinant Rat IL25 Protein

Cat.No. : IL25-5209R
Product Overview : Rat IL25 recombinant protein expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Tag : Non
Description : The protein encoded by this gene is a cytokine that shares the sequence similarity with IL17. This cytokine can induce NF-kappaB activation, and stimulate the production of IL8. Both this cytokine and IL17B are ligands for the cytokine receptor IL17BR. Studies of the similar gene in mice suggested that this cytokine may be a proinflammatory cytokine favoring Th2-type immune response. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq
Form : Lyophilized
Bio-activity : The activity is determined by the dose-dependent induction of human IL-8 production from human PBMCs. The expected ED50 for this effect is 25-37.5 ng/mL.
Molecular Mass : 35.5 kDa
AA Sequence : MCSHLPRCCPSKQQEFPEEWLKWNPAPVSPPEPLRHTHHPESCRASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHMDPMGNSVPLYHNQTVFYRRPCHGEQGAHGRYCLERRLYRVSLACVCVRPRMMA
Endotoxin : < 0.1 EU/μg
Applications : Functional Study
SDS-PAGE
Storage : Store at -20 centigrade on dry atmosphere. After reconstitution with sterilized 20 mM HCl, store at -20 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : No additive
Gene Name Il25 interleukin 25 [ Rattus norvegicus ]
Official Symbol IL25
Synonyms IL25; interleukin 25; interleukin-25; RGD1561632;
Gene ID 501996
mRNA Refseq NM_001192007
Protein Refseq NP_001178936

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All IL25 Products

Required fields are marked with *

My Review for All IL25 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon