Recombinant Human IL25 Protein

Cat.No. : IL25-165H
Product Overview : Recombinant Human IL25 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Interleukin 17E (IL-17E), also known as IL-25, is a member of the IL-17 family of cytokines. IL-17E binds to the IL-17RB receptor to stimulate the secretion of the proinflammatory interleukin 8 (IL-8) chemokine and to induce the activation of nuclear factor kappa-light-chain-enhancer of activated B cells (NF-κB).
Source : E. coli
Species : Human
Bio-activity : No biological activity data is available at this time.
Molecular Mass : Dimer, 16.9/33.7 kDa (146/292 aa)
AA Sequence : MYSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
Reconstitution : Sterile 10 mM HCl at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name IL25 interleukin 25 [ Homo sapiens (human) ]
Official Symbol IL25
Synonyms IL25; interleukin 25; IL17E, interleukin 17E; interleukin-25; IL 17E; IL 25; interleukin 17E; interleukin-17E; IL17E;
Gene ID 64806
mRNA Refseq NM_022789
Protein Refseq NP_073626
MIM 605658
UniProt ID Q9H293

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All IL25 Products

Required fields are marked with *

My Review for All IL25 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon