Recombinant Human IL25 Protein
Cat.No. : | IL25-165H |
Product Overview : | Recombinant Human IL25 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | Interleukin 17E (IL-17E), also known as IL-25, is a member of the IL-17 family of cytokines. IL-17E binds to the IL-17RB receptor to stimulate the secretion of the proinflammatory interleukin 8 (IL-8) chemokine and to induce the activation of nuclear factor kappa-light-chain-enhancer of activated B cells (NF-κB). |
Bio-activity : | No biological activity data is available at this time. |
Molecular Mass : | Dimer, 16.9/33.7 kDa (146/292 aa) |
AA Sequence : | MYSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) |
Reconstitution : | Sterile 10 mM HCl at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | IL25 interleukin 25 [ Homo sapiens (human) ] |
Official Symbol | IL25 |
Synonyms | IL25; interleukin 25; IL17E, interleukin 17E; interleukin-25; IL 17E; IL 25; interleukin 17E; interleukin-17E; IL17E; |
Gene ID | 64806 |
mRNA Refseq | NM_022789 |
Protein Refseq | NP_073626 |
MIM | 605658 |
UniProt ID | Q9H293 |
◆ Recombinant Proteins | ||
Il25-1813M | Recombinant Mouse Il25 protein, His & GST-tagged | +Inquiry |
IL25-151H | Recombinant Human IL25 Protein, His-tagged | +Inquiry |
IL25-153H | Recombinant Human IL25 protein, His-tagged | +Inquiry |
Il25-1814R | Recombinant Rat Il25 protein, His & T7-tagged | +Inquiry |
Il25-5210M | Active Recombinant Mouse Il25 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL25-1261RCL | Recombinant Rat IL25 cell lysate | +Inquiry |
IL25-2920HCL | Recombinant Human IL25 cell lysate | +Inquiry |
IL25-2910MCL | Recombinant Mouse IL25 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL25 Products
Required fields are marked with *
My Review for All IL25 Products
Required fields are marked with *
0
Inquiry Basket