Recombinant Mouse Interleukin 25

• Cat.No.: Il25-199M
• Product Overview: Recombinant Mouse IL17E produced inE.Coliis a homodimeric, non-glycosylated polypeptide chain containing a total of 306 amino acids and having a molecular mass of 34.9 kDa. The Mouse IL-17E is purified by proprietary chromatographic techniques.

Specification

• Cat. No.: Il25-199M
• Description: IL-25 also called IL-17E cytokine has a sequence similarity with IL17. IL-17E indluces NF-kappaB activation, and stimulates the production of IL-8. IL17E and IL17B are ligands for the cytokine receptor IL17BR. IL-25 is a proinflammatory cytokine favoring Th2-type immune response. The upregulation of costimulation-induced IL-17E receptors and release of cytokines and chemokines from IL-17E treated costimulated Th cells are differentially regulated by intracellular JNK, p38 MAPK and NF-kappaB activity. Blocking Iinterleukin-25 prevents airway hyperresponsiveness, a critical feature of clinical asthma. IL25 produced by innate effector eosinophils and basophils increase the allergic inflammation by enhancing the maintenance and functions of TSLP-DC activated adaptive Th2 memory cells. Over expression of IL-25 up-regulates gene expression of Th2 cytokines and induces growth retardation, jaundice, and multiorgan inflammation in a transgenic mouse model. IL-25 contributes to the induction and maintenance of eosinophilic inflammation by acting on lung fibroblasts which supports the fact that IL-17E is an important factor in asthma pathophysiology. IL-17E operates by amplifying TH2 cell-mediated allergic airway inflammation but doesn't induce allergic inflammation in vivo.
• Source: Escherichia Coli.
• Amino Acid Sequence: VSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAESCRASKDGPLNSRAIS PWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHM DPLGNSVPLYH NQTV FY RRPCHGEEGTHRRYCLERRLYRVSLACVCVRP RVMA.
• Purity: Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
• Formulation: IL17E was lyophilized from a concentrated (1mg/ml) solution containing no additives.
• Solubility: It is recommended to reconstitute the lyophilized Mouse IL17E in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
• Stability: Lyophilized Murine IL17E although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL17E should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
• Tag: Non

Gene Information

• Gene Name: Il25 interleukin 25 [ Mus musculus ]
• Synonyms: Il25; interleukin 25; Il17e; IL-17E
• Gene ID: 140806
• mRNA Refseq: NM_080729
• Protein Refseq: NP_542767
• UniProt ID: Q8VHC9
• Chromosome Location: 14 C3
• Pathway: Cytokine-cytokine receptor interaction
• Function: cytokine activity;interleukin-17E receptor binding