Active Recombinant Mouse Il7 Protein, His-Tagged

• Cat.No.: Il7-01M
• Product Overview: Recombinant mouse Il7 Protein, His-tagged was expressed in E. coli cell

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Description: Interleukin 7 (IL-7) is a protein that in humans is encoded by the IL7 gene. IL-7 stimulates the differentiation of multipotent (pluripotent) hematopoietic stem cells into lymphoid progenitor cells. It is important for proliferation during certain stages of B-cell maturation, T and NK cell survival, development and homeostasis.
• Form: Lyophilized powder
• AA Sequence: MECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNC
  TSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI with polyhistidine tag at the C-terminus
• Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
• Bio-activity: Measured in a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBMC). The ED50 for this effect is <0.2 ng/mL. The specific activity of recombinant mouse IL-7 is > 5 x 10^6 IU/mg.
• Purity: >98% as determined by SDS-PAGE. Ni-NTA chromatography
• Storage Buffer: The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
• Storage: Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
• Notes: Please use within one month after protein reconstitution.

Gene Information

• Gene Name: Il7 interleukin 7 [ Mus musculus (house mouse) ]
• Official Symbol: Il7
• Synonyms: Il-7; hlb368; A630026I06Rik
• Gene ID: 16196
• mRNA Refseq: NM_001313888.1
• Protein Refseq: NP_001300817.1
• UniProt ID: A0A8C6HCD6