Recombinant Human IL7, StrepII-tagged
Cat.No. : | IL7-271H |
Product Overview : | Purified, full-length human recombinant IL7 protein (amino acids 36-177, 142 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 20.2 kDa. (Accession NP_000871; UniProt P13232) |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Strep II |
Protein Length : | 36-177, 142 a.a. |
Description : | IL7 is a cytokine important for B and T cell development. IL7 and the hepatocyte growth factor (HGF) form a heterodimer that functions as a pre-pro-B cell growth-stimulating factor. Il7 is found to be a cofactor for V(D)J rearrangement of the T cell receptor beta (TCRB) during early T cell development. It can be produced locally by intestinal epithelial and epithelial goblet cells, and may serve as a regulatory factor for intestinal mucosal lymphocytes. IL7 belongs to the IL-7/IL-9 family. |
Form : | Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free). |
AA Sequence : | DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDF DLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTK EH |
Endotoxin : | <0.1 eu per ug protein by lal |
Purity : | >80% by SDS-PAGE |
Storage : | 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles. |
Reconstitution : | Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml. |
Gene Name | IL7 interleukin 7 [ Homo sapiens ] |
Official Symbol | IL7 |
Synonyms | IL7; interleukin 7; interleukin-7; IL 7; IL-7; |
Gene ID | 3574 |
mRNA Refseq | NM_000880 |
Protein Refseq | NP_000871 |
MIM | 146660 |
UniProt ID | P13232 |
Chromosome Location | 8q12-q13 |
Pathway | Cytokine Signaling in Immune system, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; Immune System, organism-specific biosystem; Interleukin-7 signaling, organism-specific biosystem; |
Function | cytokine activity; cytokine receptor binding; growth factor activity; growth factor activity; interleukin-7 receptor binding; protein binding; |
◆ Recombinant Proteins | ||
IL7-29H | Recombinant Human IL7 protein, His-tagged | +Inquiry |
IL7-518H | Recombinant Human IL7 Protein | +Inquiry |
IL7-069H | Active Recombinant Human IL7 Protein | +Inquiry |
IL7-2576H | Recombinant Human IL7 Protein (Asp26-His177), C-His tagged | +Inquiry |
IL7-64H | Recombinant Human IL7 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL7-5223HCL | Recombinant Human IL7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL7 Products
Required fields are marked with *
My Review for All IL7 Products
Required fields are marked with *
0
Inquiry Basket