Recombinant Human IL7, StrepII-tagged

• Cat.No.: IL7-271H
• Product Overview: Purified, full-length human recombinant IL7 protein (amino acids 36-177, 142 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 20.2 kDa. (Accession NP_000871; UniProt P13232)

Specification

• Species: Human
• Source: Human Cells
• Tag: Strep II
• Protein Length: 36-177, 142 a.a.
• Description: IL7 is a cytokine important for B and T cell development. IL7 and the hepatocyte growth factor (HGF) form a heterodimer that functions as a pre-pro-B cell growth-stimulating factor. Il7 is found to be a cofactor for V(D)J rearrangement of the T cell receptor beta (TCRB) during early T cell development. It can be produced locally by intestinal epithelial and epithelial goblet cells, and may serve as a regulatory factor for intestinal mucosal lymphocytes. IL7 belongs to the IL-7/IL-9 family.
• Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
• AA Sequence: DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDF DLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTK EH
• Endotoxin: <0.1 eu per ug protein by lal
• Purity: >80% by SDS-PAGE
• Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.

Gene Information

• Gene Name: IL7 interleukin 7 [ Homo sapiens ]
• Official Symbol: IL7
• Synonyms: IL7; interleukin 7; interleukin-7; IL 7; IL-7
• Gene ID: 3574
• mRNA Refseq: NM_000880
• Protein Refseq: NP_000871
• MIM: 146660
• UniProt ID: P13232
• Chromosome Location: 8q12-q13
• Pathway: Cytokine Signaling in Immune system, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; Immune System, organism-specific biosystem; Interleukin-7 signaling, organism-specific biosystem
• Function: cytokine activity; cytokine receptor binding; growth factor activity; growth factor activity; interleukin-7 receptor binding; protein binding