Active Recombinant Human IL7 Protein, His-tagged

• Cat.No.: IL7-234I
• Product Overview: Recombinant Human IL7 Protein with His tag was expressed in CHO.

Specification

• Species: Human
• Source: CHO
• Tag: His
• Description: Interleukin-7 (IL-7), also known as lymphopoietin 1 and pre-B cell factor, is a hematopoietic growth factor belonging to the IL-7/IL-9 family. It is produced by keratinocytes, dendritic cells, hepatocytes, neurons and epithelial cells. IL-7 binds and signals through IL-7 receptor, a heterodimer consisting of IL-7 receptor alpha and common gamma chain receptor. IL-7 plays a role in regulating early B cell and T cell development. It is also important for optimal dendritic cell-T cell interaction.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 0.2ng/mL, measured in a cell proliferation assay using 2E8 cells.
• Molecular Mass: 24-34 kDa, observed by reducing SDS-PAGE.
• AA Sequence: DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEHHHHHHH
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE.
• Storage: Lyophilized recombinant human Interleukin-7 (IL-7), His remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, human Interleukin-7 (IL-7), His should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: IL7 interleukin 7 [ Homo sapiens ]
• Official Symbol: IL7
• Synonyms: IL7; interleukin 7; interleukin-7; IL 7; IL-7
• Gene ID: 3574
• mRNA Refseq: NM_000880
• Protein Refseq: NP_000871
• MIM: 146660
• UniProt ID: P13232