Recombinant Mouse Il7 protein

• Cat.No.: Il7-77M
• Product Overview: Recombinant Mouse Il7 protein was expressed in Escherichia coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: Non
• Protein Length: 129
• Description: Interleukin-7 (IL-7) is encoded by the IL7 gene in mouse and secreted by stromal cells in the red marrow and thymus. The protein signals through the IL-7 receptor, which is a heterodimer consisting of IL-7 receptor alpha and IL-2 receptor gamma chain. IL-7 stimulates the differentiation of hematopoietic stem cells into lymphoid progenitor cells and it can stimulate proliferation of B cells, T cells and NK cells. Murine IL-7 has approximately 65 % and 88 % amino acid sequence identity with human and rat IL-7 and both proteins exhibit cross-species activity. IL-7 as an immunotherapy agent has been examined in many human clinical trials for various malignancies and during HIV infection.
• Form: Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4, 2 % trehalose.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine 2E8 cells is less than 0.2 ng/ml, corresponding to a specific activity of > 5.0 × 10⁶ IU/mg.
• Molecular Mass: Approximately 14.9 kDa, a single non-glycosylated polypeptide chain containing 129 amino acids.
• AA Sequence: ECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI
• Endotoxin: Less than 1 EU/µg of rMuIL-7 as determined by LAL method.
• Purity: >96% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: Il7
• Official Symbol: Il7
• Synonyms: IL7; interleukin 7; interleukin-7; Il-7; hlb368; A630026I06Rik; MGC129342
• Gene ID: 16196
• mRNA Refseq: NM_008371
• Protein Refseq: NP_032397
• UniProt ID: Q544C8