Active Recombinant Human TSLP Protein (132 aa)

• Cat.No.: TSLP-052T
• Product Overview: Recombinant Human TSLP Protein without tag was expressed in E. coli.

Specification

• Description: TSLP is a hemopoietic protein that is expressed in the heart, liver and prostate. TSLP overlaps biological activities with IL-7 and binds with the heterodimeric receptor complex consisting of the IL-7R alpha chain (IL-7Rα) and the TSLP-specific chain (TSLPR). Like IL-7, TSLP induces phosphorylation of STAT3 and STAT5, but uses kinases other than the JAKs for activation. TSLP prohibited apoptosis and stimulated growth of the human acute myeloid leukemia (AML)-derived cell line MUTZ3. It induces the release of T cell-attracting chemokines TARC and MDC from monocytes and activates CD11c(+) dendritic cells (DCs). TSLP activated DCs primed naive T cells to produce the proallergic cytokines (IL-4, IL-5, IL-13, TNFα) while down-regulating IL-10 and IFN-γ suggesting a role in initiating allergic inflammation.
• Source: E. coli
• Species: Human
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as measured by its ability to induce proliferation of human IL-7Rα and human TSLP R co-transfected mouse BaF3 cells is less than 0.3 ng/mL, corresponding to a Specific Activity of ＞3.3 × 10^6 IU/mg.
• Molecular Mass: Approximately 15.0 KDa, a single non-glycosylated polypeptide chain containing 132 amino acids.
• Protein length: 132
• AA Sequence: MYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
• Endotoxin: Less than 1 EU/mg of rHuTSLP as determined by LAL method.
• Purity: >98% by SDS-PAGE and HPLC analyses.
• Storage: This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
• Storage Buffer: Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 150mM NaCl.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: TSLP thymic stromal lymphopoietin [ Homo sapiens ]
• Official Symbol: TSLP
• Synonyms: TSLP; thymic stromal lymphopoietin
• Gene ID: 85480
• mRNA Refseq: NM_033035
• Protein Refseq: NP_149024
• MIM: 607003
• UniProt ID: Q969D9