Active Recombinant Human PDGFB Protein

• Cat.No.: PDGFB-149H
• Product Overview: Recombinant Human Platelet-Derived Growth Factor BB is produced by our E.coli expression system and the target gene encoding Ser82-Thr190 is expressed.

Specification

• Species: Human
• Source: E.coli
• ProteinLength: Ser82-Thr190
• Description: Platelet-Derived Growth Factor Subunit B (PDGFB) belongs to the PDGF/VEGF growth factor family. Platelet-derived growth factor is a potent mitogen for cells of mesenchymal origin. PDGFB can exist either as a homodimer (PDGF-BB) or as a heterodimer with the platelet-derived growth factor alpha polypeptide (PDGF-AB), where the dimers are connected by disulfide bonds. Mutations in this gene are associated with meningioma.Binding of PDGFB to its receptor elicits a variety of cellular responses. In addition, PDGFB is released by platelets upon wounding and plays an important role in stimulating adjacent cells to grow and thereby heals the wound.
• Form: Lyophilized from a 0.2 um filtered solution of 4mM HCl.
• Bio-activity: Measured in a cell proliferation assay using BALB/c 3T3 cells. The ED50 for this effect is 15-60ng/ml.
• AA Sequence: MSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQ LRPVQVRKIEIVRKKPIF KKATVTLEDHLACKCETVAAARPVT
• Endotoxin: Less than 0.1 ng/ug (1 EU/ug).
• Purity: >95%
• Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.
  Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.
  Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
• Quality Statement: Purity: Greater than 95% as determined by reducing SDS-PAGE.
• Shipping: The product is shipped at ambient temperature.
  Upon receipt, store it immediately at the temperature listed below.

Gene Information

• Gene Name: PDGFB platelet derived growth factor subunit B [ Homo sapiens (human) ]
• Official Symbol: PDGFB
• Synonyms: Platelet-Derived Growth Factor Subunit B; PDGF Subunit B; Platelet-Derived Growth Factor B Chain; Platelet-Derived Growth Factor Beta Polypeptide; Proto-Oncogene c-Sis; Becaplermin; SIS; SSV; IBGC5; PDGF2; c-sis; PDGF-2
• Gene ID: 5155
• mRNA Refseq: NM_002608.4
• Protein Refseq: NP_002599.1
• MIM: 190040
• UniProt ID: P01127