Active Recombinant Human PDGFB Protein

Cat.No. : PDGFB-149H
Product Overview : Recombinant Human Platelet-Derived Growth Factor BB is produced by our E.coli expression system and the target gene encoding Ser82-Thr190 is expressed.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : Ser82-Thr190
Description : Platelet-Derived Growth Factor Subunit B (PDGFB) belongs to the PDGF/VEGF growth factor family. Platelet-derived growth factor is a potent mitogen for cells of mesenchymal origin. PDGFB can exist either as a homodimer (PDGF-BB) or as a heterodimer with the platelet-derived growth factor alpha polypeptide (PDGF-AB), where the dimers are connected by disulfide bonds. Mutations in this gene are associated with meningioma.Binding of PDGFB to its receptor elicits a variety of cellular responses. In addition, PDGFB is released by platelets upon wounding and plays an important role in stimulating adjacent cells to grow and thereby heals the wound.
Form : Lyophilized from a 0.2 um filtered solution of 4mM HCl.
Bio-activity : Measured in a cell proliferation assay using BALB/c 3T3 cells. The ED50 for this effect is 15-60ng/ml.
AA Sequence : MSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQ LRPVQVRKIEIVRKKPIF KKATVTLEDHLACKCETVAAARPVT
Endotoxin : Less than 0.1 ng/ug (1 EU/ug).
Purity : >95%
Storage : Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.
Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
Quality Statement : Purity: Greater than 95% as determined by reducing SDS-PAGE.
Shipping : The product is shipped at ambient temperature.
Upon receipt, store it immediately at the temperature listed below.
Gene Name PDGFB platelet derived growth factor subunit B [ Homo sapiens (human) ]
Official Symbol PDGFB
Synonyms Platelet-Derived Growth Factor Subunit B; PDGF Subunit B; Platelet-Derived Growth Factor B Chain; Platelet-Derived Growth Factor Beta Polypeptide; Proto-Oncogene c-Sis; Becaplermin; SIS; SSV; IBGC5; PDGF2; c-sis; PDGF-2
Gene ID 5155
mRNA Refseq NM_002608.4
Protein Refseq NP_002599.1
MIM 190040
UniProt ID P01127

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PDGFB Products

Required fields are marked with *

My Review for All PDGFB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon