Recombinant Human PDGFB Protein

Cat.No. : PDGFB-523H
Product Overview : Recombinant human PDGFB protein
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Protein Length : 241
Description : This gene encodes a member of the protein family comprised of both platelet-derived growth factors (PDGF) and vascular endothelial growth factors (VEGF). The encoded preproprotein is proteolytically processed to generate platelet-derived growth factor subunit B, which can homodimerize, or alternatively, heterodimerize with the related platelet-derived growth factor subunit A. These proteins bind and activate PDGF receptor tyrosine kinases, which play a role in a wide range of developmental processes. Mutations in this gene are associated with meningioma. Reciprocal translocations between chromosomes 22 and 17, at sites where this gene and that for collagen type 1, alpha 1 are located, are associated with dermatofibrosarcoma protuberans, a rare skin tumor. Alternative splicing results in multiple transcript variants.
Form : Lyophilized
AA Sequence : MNRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAELDLNMTRSHSGGELESLARGRRSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVTRSPGGSQEQRAKTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKTALKETLGA
Purity : > 98%
Applications : WB; ELISA; FACS; FC
Stability : This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage : At -20 centigrade.
Storage Buffer : PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
Reconstitution : Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.
Gene Name PDGFB platelet-derived growth factor beta polypeptide [ Homo sapiens (human) ]
Official Symbol PDGFB
Synonyms PDGFB; platelet-derived growth factor beta polypeptide; platelet derived growth factor beta polypeptide (simian sarcoma viral (v sis) oncogene homolog) , SIS; platelet-derived growth factor subunit B; becaplermin; oncogene SIS; SSV; PDGF-2; PDGF, B chain; PDGF subunit B; proto-oncogene c-Sis; platelet-derived growth factor 2; platelet-derived growth factor B chain; platelet-derived growth factor, B chain; Platelet-derived growth factor, beta polypeptide (oncogene SIS); platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog); SIS; PDGF2; c-sis; FLJ12858;
Gene ID 5155
mRNA Refseq NM_002608
Protein Refseq NP_002599
MIM 190040
UniProt ID P01127

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PDGFB Products

Required fields are marked with *

My Review for All PDGFB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon